social anxiety jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

social anxiety Job Openings

Showing 4301 - 4350 of 7684 Jobs

Beauty Salon Manager

NEW ERA LIFE CARE PRIVATE LIMITED 5.00 to 10.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Delhi 29 Oct, 2024

Graphic Designer

BRANDZSTORM INDIA MARKETING PRIVATE LIMITED 2.00 to 5.00 Years Mumbai City 29 Oct, 2024

TASKS / KRA Graphic Design

creative designing

graphic designing

Child Psychologist

SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 16.00 to 25.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Delhi, Port Blair 29 Oct, 2024

psychological services

Lead Generation Executive

ZACO COMPUTERS PRIVATE LIMITED 1.00 to 2.00 Years Mumbai City 29 Oct, 2024

Job Title: Lead Generation Executive

Company: Zaco Computers Private Limited

Web: www.zacocomputer.com

Location: Goregaon, Mumbai cold callingdemand generation

Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Mumbai City,Pune, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Delhi 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.

Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Restaurant Manager
SAURASHTRA CEMENT LIMITED 15.00 to 18.00 Years Mumbai City 29 Oct, 2024

Job Position: Restaurant Manager Experience: 15-18 years Age:- 34-35 Location: Kemps corner and bandra Salary Budget: 50,000 ctc Job Description 1. Coordinating daily restaurant management oper...
italian cuisinerestaurant managementrestaurant customer servicefine dining

Motion Graphic Designer
Epicenter Technologies Private Limited 3.00 to 8.00 Years Mumbai City,Mira Bhayandar 29 Oct, 2024

Role: Motion Graphics designer Experience: 3 to 5 years relevant experience Education: Bachelors, Post Grad or equivalent Domain: wireframesmotion graphics2d animationmotion graphic designsocial mediapage layouttypography

Ecommerce Deputy Sales Manager
BRANDZSTORM INDIA MARKETING PRIVATE LIMITED 5.00 to 8.00 Years Mumbai City 29 Oct, 2024

Job Description Role Title: Ecommerce Deputy Sales Manager Marketplace Educational Qualification: BCOM/ BA/ NIFT, PGDM (Marketing) Department: Sales Work Experience (No. of years and Industry): 3...
ecommerce developmentecommerce

Creative Design Associate (Graphic)
Quess Corp (Magna Infotech) 1.00 to 3.00 Years Mumbai City 29 Oct, 2024

Position Overview: We are seeking a creative and detail-oriented Graphic Designer to join our dynamic team. The ideal candidate will be proficient in Adobe InDesign and possess a...
graphic designindesignmotion graphicsgraphic animationphotoshopweb designing

Opening for Fresher at SBILife - Mumbai
SBI Life Insurance Company Limited 0.00 to 3.00 Years Navi Mumbai,Mumbai City, Thane, Palghar, Dombivali 29 Oct, 2024

We are seeking a highly motivated and ambitious Assistant Trainee - Development Manager Retail to join our team at SBI Life Insurance and contribute to the growth and success of our retail busine...
business developmentinsurance

HR Recruiter freelancer
NEEDION SOLUTIONS PRIVATE LIMITED 0.00 to 1.00 Years Hyderabad,Other Telangana, Guntur, Other Tamil Nadu, Other Andhra Pradesh, Other Kerala, Guntakal, K 29 Oct, 2024

Position: HR Recruiter Edu: Any Languages: Any ( Hindi/ Tamil/ Telugu/ Malayalam/ Kannada/ English) Location: Remote (Work From Home) Salary: monthly freelancer A recruiters job is sourcingrecruiting

Talent Acquisition Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop and maintain job descriptions for various roles.

Identify and attract potential candidates through diverse online platforms (e.g., social media and professional netwo...
hiringselectionoffer generationinterviewingleadership skillspostingstaffingrecruitment managementcommunication skills

Behavioral Technician
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 15.00 to 25.00 Years Hyderabad,Bangalore, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Were looking for a dedicated and compassionate Behavioral Technician to join our medical team. Behavioral Technicians are responsible for assisting Behavior Analysts with treatment plans designed...
disabilitiesanalysishealthmanagementkidsrbtbcbaautismhomeworkdevelopmentalbehaviorsocial

HR Recruiter freelancer
NEEDION SOLUTIONS PRIVATE LIMITED 0.00 to 1.00 Years Hyderabad,Other Telangana, Guntur, Other Tamil Nadu, Other Andhra Pradesh, Other Kerala, Guntakal, K 29 Oct, 2024

Position: HR Recruiter Edu: Any Languages: Any ( Hindi/ Tamil/ Telugu/ Malayalam/ Kannada/ English) Location: Remote (Work From Home) Salary: monthly freelancer A recruiters job is sourcingrecruiting

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Noida, Nellore, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Graphic Designer cum Video Editor
LAGRAN SOFTWARE SOLUTIONS PRIVATE LIMITED 3.00 to 5.00 Years Hyderabad 29 Oct, 2024

Job Role : Graphic cum Video Editor Location :Hyderabad Experience : 3 yrs Job Type : Full time Job Timings : 9:30 a.m to 6:00 p.m 6 days working Jd : Create visually appealing graphics for digit...
softwarevisual effectstypography

Child Psychologist
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 16.00 to 25.00 Years Hyderabad,Bangalore, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Child Psychologist to join our team and provide compassionate care to children and teens suffering from a variety of disorders, such as ADHD, anxiety and depression. Child P...
family therapydbtgroup therapymental healthtreatment servicesautismpsychological testssubstance abusepsychological services

Recruitment Business Partner
NEW ERA LIFE CARE PRIVATE LIMITED 17.00 to 23.00 Years Hyderabad,Bangalore, Ongole, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Recruitment Business Partner to join our HR department and help develop and implement successful recruiting strategies. Recruitment Business Partner responsibilities include...
customerbusinessmanagementanalyticsperformanceserviceengagementhealthcareexcellentresourcesemployeehumaninterpersonalprojectobjectivesservices

Beauty Salon Manager
NEW ERA LIFE CARE PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 29 Oct, 2024

We are looking for a Beauty Salon Manager to be responsible for our salons day-to-day operations. Beauty Salon Manager responsibilities include supervising staff, scheduling shifts, promoting ou...
controlgoodinventoryretailpetsalesguestcosmetologyproductsknowledgegrassexceptionalclipsjudgment

Child Psychologist
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 16.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Port Blair 29 Oct, 2024

We are looking for a Child Psychologist to join our team and provide compassionate care to children and teens suffering from a variety of disorders, such as ADHD, anxiety and depression. Child P...
family therapydbtgroup therapymental healthtreatment servicesautismpsychological testssubstance abusepsychological services

Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.

Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Talent Acquisition
Veerwal Getwork Services Private Limited 1.00 to 2.00 Years Gurugram 29 Oct, 2024

Key Responsibilities

Drive High-Volume Recruitment: Manage end-to-end recruitment for multiple roles, ensuring a smooth, effective, and timely...
bulk mailingrecruitment

Content Writer Female
SAHYOG RECRUITMENT AGENCY 0.00 to 4.00 Years Delhi 29 Oct, 2024

Urgent Hiring for Content Writer Female Position: Content Writer Female Job Location: Laxmi Nagar Delhi Experience: 0 to 5 Years Qualification: Any Graduate Jobs Responsibilities: copy writingcontent writing

Talent Acquisition Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 29 Oct, 2024

Develop and maintain job descriptions for various roles.

Identify and attract potential candidates through diverse online platforms (e.g., social media and professional netwo...
hiringselectionoffer generationinterviewingleadership skillspostingstaffingrecruitment managementcommunication skills

Behavioral Technician
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 15.00 to 25.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Port Blair 29 Oct, 2024

Were looking for a dedicated and compassionate Behavioral Technician to join our medical team. Behavioral Technicians are responsible for assisting Behavior Analysts with treatment plans designed...
disabilitiesanalysishealthmanagementkidsrbtbcbaautismhomeworkdevelopmentalbehaviorsocial

Community Marketing
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Delhi,Noida, Bangalore, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Other AndamanNicobar, Port Bl 29 Oct, 2024

We are looking for a Director of Customer & Community Marketing to spearhead our community-building and customer engagement efforts. In this role, you will be responsible for creating and nurtur...
servicesupportdeliverylogisticsdevelopmentcommunicationcustomersalesprocessmanagementskillsemployeesatisfactioncontinuousautoimprovement

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Delhi,Noida, Bangalore, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Program Manager-IT
T AND M SERVICES CONSULTING PVTLTD 7.00 to 12.00 Years Chennai 29 Oct, 2024

Dear Candidate, Job Opening for the profile of Program Manager-IT Please find below attached JD- Name of Position- Program Manager-IT Roles and Responsibilities

serviceenterpriseweb servicesdata warehousingapi

Community Marketing
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Chennai,Bangalore, Noida, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Other AndamanNicobar, Port Bl 29 Oct, 2024

We are looking for a Director of Customer & Community Marketing to spearhead our community-building and customer engagement efforts. In this role, you will be responsible for creating and nurtur...
servicesupportdeliverylogisticsdevelopmentcommunicationcustomersalesprocessmanagementskillsemployeesatisfactioncontinuousautoimprovement

Behavioral Technician
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 15.00 to 25.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Were looking for a dedicated and compassionate Behavioral Technician to join our medical team. Behavioral Technicians are responsible for assisting Behavior Analysts with treatment plans designed...
disabilitiesanalysishealthmanagementkidsrbtbcbaautismhomeworkdevelopmentalbehaviorsocial

Sales Team Leader
India filings Pvt Ltd 3.00 to 6.00 Years Chennai 29 Oct, 2024

JOB Title:Sales Team Leader Sales Manager Key Responsibilities:

Create effective sales models to improve the sales funnel.

Ensure achieve...
bpo salesfinance product sales

Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.

Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Recruitment Business Partner
NEW ERA LIFE CARE PRIVATE LIMITED 17.00 to 23.00 Years Chennai,Bangalore, Ongole, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Recruitment Business Partner to join our HR department and help develop and implement successful recruiting strategies. Recruitment Business Partner responsibilities include...
customerbusinessmanagementanalyticsperformanceserviceengagementhealthcareexcellentresourcesemployeehumaninterpersonalprojectobjectivesservices

Digital Marketing Manager
Pneumatic Vacuum Elevators and Lifts-India Private Limited 3.00 to 8.00 Years Chennai 29 Oct, 2024

Job Title: Digital Marketing Manager - U.S. based Home Elevator Manufacturing company near Chennai. Job Summary - We are looking for a skilled Digital Marketing Manager to join our team - a l...
seodigital marketingcreative designinginternet researchinternet marketingonline lead generationcreative writingcreative optimization

Communications Assistant
NEW ERA LIFE CARE PRIVATE LIMITED 20.00 to 25.00 Years Bangalore,Ongole, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Communications Assistant to provide administrative support to various teams and programs. Editing and writing company materials will be an important part of your job. In thi...
webdeskresolutioncontentcustomerpresstelephoneresidentialconflictfrontserviceadministrativelifecallsreleases

Business Development
Ginger Media Group 2.00 to 7.00 Years Bangalore 29 Oct, 2024

Job Title: Business Development Manager (Sales) Role Definition: Business Development (Sales) Manager would be primarily responsible to attracting new business clients through different sales c...
b2b marketingb2b salesbusiness development

Community Marketing
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Bangalore,Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Other AndamanNicobar, Port Bl 29 Oct, 2024

We are looking for a Director of Customer & Community Marketing to spearhead our community-building and customer engagement efforts. In this role, you will be responsible for creating and nurtur...
servicesupportdeliverylogisticsdevelopmentcommunicationcustomersalesprocessmanagementskillsemployeesatisfactioncontinuousautoimprovement

Beauty Salon Manager
NEW ERA LIFE CARE PRIVATE LIMITED 5.00 to 10.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Beauty Salon Manager to be responsible for our salons day-to-day operations. Beauty Salon Manager responsibilities include supervising staff, scheduling shifts, promoting ou...
controlgoodinventoryretailpetsalesguestcosmetologyproductsknowledgegrassexceptionalclipsjudgment

Community Marketing
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Bangalore,Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Other AndamanNicobar, Port Bl 29 Oct, 2024

We are looking for a Director of Customer & Community Marketing to spearhead our community-building and customer engagement efforts. In this role, you will be responsible for creating and nurtur...
servicesupportdeliverylogisticsdevelopmentcommunicationcustomersalesprocessmanagementskillsemployeesatisfactioncontinuousautoimprovement

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Behavioral Technician
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 15.00 to 25.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Were looking for a dedicated and compassionate Behavioral Technician to join our medical team. Behavioral Technicians are responsible for assisting Behavior Analysts with treatment plans designed...
disabilitiesanalysishealthmanagementkidsrbtbcbaautismhomeworkdevelopmentalbehaviorsocial

Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.

Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Graphic Designer
Ginger Media Group 0.00 to 1.00 Years Bangalore 29 Oct, 2024

Graphic Designer Internship Job Description Ginger Media Group is seeking a talented and passionate Graphic Designer intern to join our dynamic team. As an int...
graphic designingadobe photoshopvideo editing

Business Development Manager (Marketing Service Sales )
IMS people possible 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

Excellent Communication Skill Experience : 2 to 4 Years in Marketing Service Sales Market Research and Analysis: Conduct market research to identify potential business opportunities and trends....
Strategic PlanningClient Relationship ManagementNetworkingRisk ManagementSocial Media ManagementHootsuiteContent CreationExcellent Communication SkillMarket ResearchAnalysisSalesRevenue GenerationProposalPresentation DevelopmentNegotiation

Lead Generation
SetuBridge Technolabs 2.00 to 6.00 Years Ahmedabad,Other Gujarat 29 Oct, 2024

SetuBridge Technolabs is looking for a highly skilled and experienced Lead Generation Specialist to join our dynamic team. As a Lead Generation Specialist, you will play a crucial role in identify...
Microsoft Office SuiteSocial Media PlatformsMarketing ConceptsCustomer BehaviorOrganizational SkillsAnalytical MindsetPositive Attitude

Business Development Executive - CASA (Ahmedabad)
CSB Bank Ltd 1.00 to 6.00 Years Ahmedabad 29 Oct, 2024

Exciting New Opportunity - CSB Bank is hiring Business Development Executive CASA. Job Purpose: To promote products and services of the Bank, with an ai...
current accountsalescasa

Assistant Sales Manager (BANCA)
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 0.00 to 3.00 Years Ahmedabad 29 Oct, 2024

Position: Assistant Sales Manager Department: TPD Banca Sales Job Summary: This position focuses on building and maintaining strong relations...
assistancebanca salessalesbancassurancelife insurance

Assistant Manager Supply Chain (Social) for Cotton Industry
IMPACT CONSULTANTS 5.00 to 10.00 Years Ahmedabad,Rajkot, Aurangabad, Pune 29 Oct, 2024

A leading MNC Cotton company ishiring Asst. Manager Supply Chain (Social) Key Accountabilities:

The incumbent will help in implementing social conduc...
supply chaincomplianceginnersoraganic cotton

RPA Power Platform Developer
Avertis Infotech Private Limited 5.00 to 10.00 Years Pune 24 Oct, 2024

Requirements and Responsibilities:

Proficiency in designing, developing and maintaining solutions within the Power Platform ecosystem, with a focus on Power Automate (...
uipathblue prismsqlpower biazurepower app

Hiring for Parent Relationship Manager Kalyani Nagar Pune
HR Globe Recruitment Service 2.00 to 7.00 Years Pune 24 Oct, 2024

Dear Candidates, Hiring for Parent Relationship Manager Kalyani Nagar Pune CTC: Rs.30000-Rs.40000 incentives This is a full-time position. Working hours would be from 8:30 am - 4:30 pm Monday ...
preschoolcold callingparent-child relationshipspre-ksalesadmission counselling

PREV
NEXT

social anxiety Job Openings

Key Responsibilities

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers