supply chain domain jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

supply chain domain Job Openings

Showing 3401 - 3450 of 15041 Jobs

Customer Support Domestic Voice Process

PERSONAL NETWORK Fresher Bangalore 01 Oct, 2025

Customer Support Domestic Voice Process (English & Hindi)

inbound callsdomestic voice processoutbound callingcustomer service

Technology Analyst IT Services | Cisco Network Core | Bangalore / Pune
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Bangalore, Pune 01 Oct, 2025

Hiring: Technology Analyst IT Services | Cisco Network Core | Bangalore / Pune Career Level: 4 / 4A Experience: 4 8 Years Location: ccnpinfrastructurehiringnetworkingcoretechnologynetworkpuneanalyst ciscospecialistservicescareersbangalore

Manual Testing with Banking Domain (Mumbai & Banglore )
PANTA STAFFING SOLUTIONS LLP Fresher Bangalore, Mumbai City 01 Oct, 2025

Junior Test Engineer (Adobe) Manual Testing 1 - 3 Yrs -Mumbai - Arioli -Face to Face Interview Manual testing Banking domain(Only Male Profiles)
bfsifunctionalinsurancebankingmanual

Python Software Engineer (AI-Focused)
NetAnalytics LLC Fresher Ahmedabad, Gujarat 01 Oct, 2025

You will be joining a fast-paced, innovation-driven environment where you will have the opportunity to build intelligent software systems and receive direct AI/ML training. This unique role is tai...
PythonOOPData StructuresAlgorithmsDatabasesGitREST APIsTensorFlowPyTorch

Export / Import Manager
Confidential Fresher Ahmedabad 01 Oct, 2025

Job Title: Export / Import Manager Industry: Textile & Apparel (Fashion) Department: Procurement & Supply Chain Employment Type: Full-Time, Permanent Role Category: Import & Export Role Overview...
export importexport sales

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 28 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Noida, DelhiDelhi, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 28 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Software Developer C / .NET (Algo Trading Systems)
E4 SOFTWARE SERVICES PRIVATE LIMITED Fresher Navi Mumbai, Mumbai City 28 Sep, 2025

Software Developer C / .NET (Algo Trading Systems)
Experience Required: 2 to 3 years Job Location: [Juinagar - Mumbai ] Employment Type: Full-time Interview Mode : 01st round - virtua...
asp.netalgomvc architecturelinuxalgorithm developmentmysqlbash scriptingdesign patterns

JD Edwards SND Consultant
LTIMindtree Limited Fresher Hyderabad, BangaloreBangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Hyderabad, BangaloreBangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 28 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Gurugram, DelhiDelhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 28 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Appian Tech Lead
Best Infosystems Ltd Fresher Delhi 28 Sep, 2025

Appian Tech Lead_Full-Time_Remote_India Job Tittle: Appian Tech Lead Job Type: Full-Time Experience: 8 years in IT, with a minimum of 6 years in Appian development Location: Remote (India-based ...
leadershiptechnical

Tech & Enablement Specialist, Remote position for Top IT Companies
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Chennai, BangaloreBangalore, Hyderabad, Gurugram, Mumbai City 28 Sep, 2025

Role:Tech & Enablement Specialist Shift Timing:US Shift (Flexibility required) Experience:3 to 7 Years Job Ty...
engineeringsciencebusinessproductioncommunicationcomputerpowersupportmanagementaccesssalesforceecctechnicaldocumentationoperationscoordinationsapenablementtechcompliancechatgptglobalskillsshiftuserremotes/4hanadeploymen

Analyst 3, Supply Chain Planning
Comcast Fresher Chennai, Tamil Nadu 28 Sep, 2025

Role Overview: As a Senior Supply Planner at Comcast, you will be responsible for managing inventory levels and availability, overseeing product lifecycle management, and contributing to strategic...
Inventory ManagementProduct Lifecycle ManagementData AnalysisBusiness IntelligenceAnalyticsSalesOperations Planning SOPSupplier Performance ManagementStrategic Supply Chain Planning

Analyst 2, Supply Chain Planning
Comcast Corporation Fresher Chennai, Tamil Nadu 28 Sep, 2025

Job Description Role Overview: As a Supply Chain Coordinator at Comcast, you will be responsible for managing freight planning, vendor coordination, shipment tracking, and cost control to ensure ...
Strong analytical skillsTMSAPICSAttention to detailExperience in purchase order PO management oversightFamiliarity with planning systems such as AnaplanProficiency in ERP tools including SAPARIBA

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bangalore, ChennaiChennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

ERP Functional Consultant
FinByz Tech Fresher Ahmedabad, Gujarat 28 Sep, 2025

Role Overview: As an ERP Functional Consultant, you will utilize your industry experience and expertise in various business domains to provide consulting services for ERP implementations. Your key...
testingbusiness process mappingrequirements gatheringERP functional consultingbusiness requirements managementenduser trainingprocess flows designsolution designstrainingmentoring

Opportunity for AWS Cloud Architect Role in Pune
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune 25 Sep, 2025

We are currently looking for an AWS Cloud Architect with 7 to 10 years of experience to join our team in Pune. Below are the key details of the role: Role: AWS Cloud Architect Experience: 7 to ...
awscloud

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 25 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 25 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 25 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 25 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 25 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

JD Edwards SND Consultant
LTIMindtree Limited Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 25 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

SAP Work Manager Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

SAP WorkManager: Primary Skill: SAP Work Manager Delivery Role: Sr. Developer Experience Profile: 06-10 years Candidate should have good knowledge and working experience of SAP Agentry/Work M...
spmmobile developmentjavasap work managerworkdevelopermanager

Senior Manager
BEMCON ENGINEERING PRIVATE LIMITED Fresher Ahmedabad, AnandAnand, Bharuch, Bhavnagar, Ankleshwar, Bilaspur, Amalapuram, Bhillai, Korba, Anantpu 25 Sep, 2025

Conduct market research to identify and qualify potential new customers

Segment customers cohorts and create GTM strategy based on customer requirements in these cohorts
...
strategic planningleadershipbudget management

Manufacturing Materials Procurement & Inventory Management Entry Professional
Hitachi Careers Fresher Vadodara, Gujarat 24 Sep, 2025

As a Factory Buyer at Hitachi Energy in Maneja-Vadodara, India, you will be an integral part of the Transformers Business Unit (BU) team. This team is dedicated to utilizing innovative technology ...
ProcurementSupply Chain ManagementVendor ManagementInventory ManagementCost OptimizationERPSAPLean ManufacturingKANBANVMIRisk EvaluationEngineering Drawing

PHP & WordPress Developer
SEOWebPlanet Solutions - Digital Marketing Company in India Fresher Vadodara, Gujarat 24 Sep, 2025

As a WordPress Developer, you will be responsible for developing websites on WordPress based on the provided design with meticulous attention to detail. You will collaborate closely with the desig...
WordPressPSDHTMLHTML5CSS3JavaScriptPHPDebugging ToolsFigmaWordPress ThemingACF ProElementor

Recruiter / Junior Recruiter BFSI Recruitment
Team Ace HR LLP Fresher Mumbai City 24 Sep, 2025

Job Title: Recruiter / Junior Recruiter BFSI Recruitment Location: Goregaon West, Mumbai (2 minutes wa...
recruitmentsourcingtalent acquisitionbfsi recruitmentscreening resumes

Human Resources Executive
AllcargoGATI Fresher Surat, Gujarat 24 Sep, 2025

As an Executive - HR based in Surat Palsana location, your role will involve handling day-to-day HR operations and ensuring smooth coordination between teams and departments. Your key responsibili...
Employee EngagementVendor ManagementStrong interpersonalcommunication skillsAdvanced Excel for data analysisreportingTime Office operationslabor law compliance

Stock Audit Manager Retail Stores
Zion Corp Fresher Rajkot, Gujarat 24 Sep, 2025

The Stock Audit Manager is responsible for overseeing and conducting stock audits across multiple retail store locations to ensure inventory accuracy, identify discrepancies, and prevent stock los...
Analytical skillsInventory managementMicrosoft ExcelCommunication skillsProblemsolving skillsAttention to detailReporting skillsRetail stock management

Dy Manager - SCPC Buying
Mahindra Group Fresher Rajkot, Gujarat 24 Sep, 2025

You will be responsible for planning and procurement of parts for 4 platforms: LTV, MHCV, U202, W201, approximately 800 - 1000 parts per platform. Your role will involve coordinating with supplier...
Communication SkillsNegotiationRelationship ManagementConflict ManagementProcurementBenchmarkingCost ManagementCost Reduction ManagementMarket ResearchLogistics SystemsDigitizationAnalyticsSupplier DevelopmentSourcingInventory ManagementInf

DABUR INDIA LIMITED
SLN ENTERPRISES Fresher Bhubaneswar, CuttackCuttack, Jharsuguda, Paradeep, Puri, Rourkela, Sambalpur, Bangalore, Odisha, Him 24 Sep, 2025

Contact Person:73.03.48.90.92 ( Riya Sharma) Dabur India limited Hiring for Ware house Supervisor for one of leading FMCG company. warehouse operationsoder processinginventory managementdispatchinventory controlcommunication skillswarehouse managementsupply chain managementdistribution management

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

General Manager - Logistics Operations
FTJ Consultants Fresher Ranchi, JamshedpurJamshedpur, Patna, Kanpur, Lucknow, Kolkata, Durgapur 24 Sep, 2025

General Manager - Logistics Operations Role & Responsibilities: - Handling general administration of the assigned area and accountable for monitoring the overall sales operatio...
material managementwarehouse operationsfreightsupply chainsupply planning

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, JammuKashmir, Gujarat, Madhya Pradesh, Ahmednagar, Jharkhand, Karnataka, Himachal 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Area Service Incharge B
Reliance Jio Infocomm Limited Fresher Jalandhar, Punjab 24 Sep, 2025

As a Service Center Manager in our company located in Jalandhar, your role will involve: - Establishing and maintaining the upkeep of service centers - Liaising with store managers and sales team...
Team managementMarket knowledgeRelationship managementExperience in areazone for device repair operationsGeography knowledgeDelegation skillsDiversity managementDomain knowledge of telecom deviceExpertise in field repair operations

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Andhra Pradesh, BiharBihar, Gujarat, Haryana, Karnataka, Maharashtra, Punjab, Telangana, Uttar Prade 24 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Andhra Pradesh, BiharBihar, Gujarat, Haryana, Karnataka, Maharashtra, Punjab, Telangana, Uttar Prade 24 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Distribution Manager
TERCELHERBS PRIVATE LIMITED Fresher Kollam, GurugramGurugram, Mumbai City, Bangalore, Chennai, Noida, Hyderabad, Kolkata, Pune, Delhi 24 Sep, 2025

a distribution manageroversees the efficient, safe, and timely movement of products from point of origin to final destination, managing inventory, coordinating staff, optimiz...
chainoperationsmanagementsupplycommunication skillslogistics

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Logistics Officer
SHARMA ENTERPRISES Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Guntakal, Anantpur, Dhubri, Dibrugarh, Guwahati 24 Sep, 2025

We are looking for a detail-oriented and organized Logistics Officer to join our team. The Logistics Officer will be responsible for coordinating the transportation, storage, and distribution of ...
supply chain managementcustomer serviceinventory managementproblem solvingadaptabilitylogistics managementdelivery operationsteamwork

PREV
NEXT

supply chain domain Job Openings

Customer Support Domestic Voice Process (English & Hindi)

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Software Developer C / .NET (Algo Trading Systems)

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation