google cloud platform jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

google cloud platform Job Openings

Showing 6201 - 6250 of 21893 Jobs

Marketo

LTIMindtree Limited Fresher Pune 25 Sep, 2025

Marketo

Opportunity for AWS Cloud Architect Role in Pune

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune 25 Sep, 2025

aws

cloud

Urgent Hiring for International

ARTECH INFOSYSTEMS PRIVATE LIMITED Fresher Mumbai City, Bangalore 25 Sep, 2025

Qualification Any graduate (mandatory)

Mode of Work (WFH or WFO) -

Interview process

Versant Thresh...
customer supportinternational call centervoice process

Senior Gen AI Engineer
Delta Sys-Tech (India) Pvt Ltd Fresher Hyderabad 25 Sep, 2025

Permanent job opening for Gen AI Engineer with US MNC organization at Hyderabad Required skills 5 years of professional experience in building Machine Learning models & systems...
machine learningartificial intelligencepythonlanggraphlangchainraggenerative ai

Adobe Analytics(dashboardSQL)
LTIMindtree Limited Fresher Hyderabad 25 Sep, 2025

An Adobe Support is a technical role responsible for Tier 1 Support using Adobe Experience Cloud products Their responsibilities typically span architecture solution design integration governanc...
Adobe Campaign

Technical Architect Associate
Chetu India Pvt Ltd Fresher Noida 25 Sep, 2025

Job Summary We are looking for a Technical Architect Associate who will assist in designing, developing, and implementing scalable technology solutions using AI/ML, Python, Java...
intelligencejavascriptpythonjava

Senior Software Engineer 2
C3 India Delivery Centre LLP (formerly known as Crowe Horwath IT Services LLP) Fresher Noida, Uttar Pradesh 25 Sep, 2025

As a Senior Software Engineer II at C3 India Delivery Centre LLP, formerly known as Crowe Horwath IT Services LLP, you will be part of the Audit Transformation practice focusing on research, rapid...
RDBMSAzuremicroservicesAPIsPythonRustpresentation skillsMicrosoft technology stackNET frameworkfrontend developmentJavaScript frameworkNoSQL databasescloud platformserverlessAIML conceptsDevOps toolsAzure AI Foundry

Senior Software Development Engineer 2
SBS Fresher Noida, Uttar Pradesh 25 Sep, 2025

As an experienced professional with 6-8 years of experience, you will play a crucial role in the architectural design of the product, contributing your deep technical expertise. You will be respon...
JavaSpringSpring BatchMongoDBPostgreSQLRedisAngularCloud computingData structuresAlgorithmsDigital transformationAgile methodologiesMicroservices architectureReactive programmingEnterprisegrade components

ServiceNow SAM ITAM
MNR Solutions Pvt Ltd Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Pune, Delhi 25 Sep, 2025

Dear Candidates, Currently hiring for a Japanese MNC Looking for a ServiceNow SAM ITAM on Contractual role of 1-2 year Exp-5years NP-Immediate /Aug serving max Location-Chennai/Pune/Bangalore...
servicenowit asset managementitam

SAP Work Manager Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

SAP WorkManager: Primary Skill: SAP Work Manager Delivery Role: Sr. Developer Experience Profile: 06-10 years Candidate should have good knowledge and working experience of SAP Agentry/Work M...
spmmobile developmentjavasap work managerworkdevelopermanager

Adobe Analytics(dashboardSQL)
LTIMindtree Limited Fresher Chennai 25 Sep, 2025

Job Description An Adobe Support is a technical role responsible for Tier 1 Support using Adobe Experience Cloud products Their responsibilities typically span architecture solu...
Adobe AnalyticsCampaign

Sales Development Representative
Live Connections Fresher Bangalore 25 Sep, 2025

KEY RESPONSIBILITIES: Identify/ Research prospects such as CIOs, IT directors from enterprise and government organization Make outbound calls to build early stage relationships and develop and...
businesssales developmentsales department processesgenerationcold callingdevelopmentinside sales

Sr. Data Engineer (Azure Synapse)
Versent Systems Ltd Fresher Ahmedabad, Gujarat 25 Sep, 2025

Role Overview: As a Senior Data Engineer with 5 to 8 years of experience and expertise in Azure Synapse and deep Azure data engineering, you will be responsible for designing and implementing data...
Data ArchitectsData engineeringAnalytical skillsAPIsDatabasesAzure DevOpsAzure SynapseAzure data engineeringData technologyData platform solutionsPresales ArchitectsCloud EngineersAzure data servicesProblemsolving skillsData pipelinesFile f

MERN Stack Developer
Arihant HR Consultancy Fresher Ahmedabad 25 Sep, 2025

Key Responsibilities

Develop and maintain end-to-end applications using MongoDB, Express.js, React.js, and Node.js.

Convert Figma/UI designs into responsive and interactive i...
restful apisawsnode.jsresponsive web designreact.jsexpress.js

Sales Distributor
Saathi Fresher Ahmedabad, Gujarat 25 Sep, 2025

As a Sales & Distribution personnel at Saathi, your role will involve developing and implementing sales & distribution plans for Saathi sanitary pads locally and internationally. You will be respo...
distributorsMicrosoft OfficedocumentationEnglishModern TradeGeneral tradeInternational salesStrategic thinkingCompetitive analysisAdobe Creative Suiteknowledge of consumer product channelsecommerce platformFMCG IndustryStrong writtenverbal c

Backend .NET Developer
AppleTech Fresher Vadodara, Gujarat 24 Sep, 2025

As a Web Application Developer at AppleTechSoft, you will be required to have a minimum of 5 years of hands-on experience in developing web applications on the Microsoft Windows Platform and cloud...
Software DesignArchitectureREST APIOODAOPSQL ServerSQL QueriesJOINSDatabase DesignLINQDebuggingAnalytical SkillsJAVASCRIPTDOJODockerMicrosoft TechnologiesVerbal CommunicationWritten CommunicationMicrosoft Windows PlatformCloud Technolog

Machine Learning Engineer
Sunflower Lab Fresher Vadodara, Gujarat 24 Sep, 2025

As a Machine Learning Engineer, you will be responsible for designing and implementing scalable machine learning models throughout the entire lifecycle - from data preprocessing to deployment. You...
PythonNumPySparkPandasScikitlearnTensorFlowPyTorchMLflowKubeflowDaskAWS SageMakerGCP AI PlatformWeightsBiasesDVCRay

Web Content Writer
Tempsens Instruments (I) Pvt Ltd Fresher Udaipur, Rajasthan 24 Sep, 2025

As a Technical Content Writer at Tempsens located in Udaipur, Raj, you will play a crucial role in creating high-quality content for the companys website, blogs, and marketing materials. Your prim...
Keyword researchGoogle AnalyticsWritten communicationVerbal communicationSEOoptimized technical content writingContent marketing strategiesContent management systems CMS

Recruiter / Junior Recruiter BFSI Recruitment
Team Ace HR LLP Fresher Mumbai City 24 Sep, 2025

Job Title: Recruiter / Junior Recruiter BFSI Recruitment Location: Goregaon West, Mumbai (2 minutes wa...
recruitmentsourcingtalent acquisitionbfsi recruitmentscreening resumes

MERN Full Stack Developer
Xcellence-IT Fresher Surat, Gujarat 24 Sep, 2025

You will be joining a dynamic and forward-thinking IT solutions company, Xcellence-IT, as a MERN Full Stack Developer. In this role, you will be responsible for designing, developing, and maintain...
JavaScriptHTML5CSS3MongoDBRESTful APIsWeb servicesAWSAzureMochaMERN stackExpressjsReactjsNodejsVersion control systemsAgile development methodologiesTypeScriptGraphQLCICD

Senior React.js Developer
Inventam Tech Solution ( OPC ) Fresher Surat, Gujarat 24 Sep, 2025

As a Senior React.js Developer at our innovative IT services company specializing in cutting-edge software solutions, you will be at the forefront of developing an advanced finance and trading app...
JavaScriptHTML5CSS3WebSocketsAWSAzureReactjsTypeScriptReduxMobXContext APIMaterial UIAnt DesignNextjsD3js

Machine Learning Engineer
Eyushion TechSol Pvt Ltd Fresher Rajkot, Gujarat 24 Sep, 2025

As a Machine Learning Engineer, you will be responsible for all aspects of a production machine learning system. Your tasks will include acquiring data, training and building models, deploying mod...
Machine LearningComputer VisionDeep LearningPythonAWSDockerKubernetesAPIsTensorFlow

Dy Manager - SCPC Buying
Mahindra Group Fresher Rajkot, Gujarat 24 Sep, 2025

You will be responsible for planning and procurement of parts for 4 platforms: LTV, MHCV, U202, W201, approximately 800 - 1000 parts per platform. Your role will involve coordinating with supplier...
Communication SkillsNegotiationRelationship ManagementConflict ManagementProcurementBenchmarkingCost ManagementCost Reduction ManagementMarket ResearchLogistics SystemsDigitizationAnalyticsSupplier DevelopmentSourcingInventory ManagementInf

Node.js Developer
R K Infotech Fresher Rajkot, Gujarat 24 Sep, 2025

As a Node JS Developer at our dynamic and fast-paced team dedicated to driving digital transformations, your role will involve: - Strong proficiency with JavaScript - Knowledge of Node.js and var...
JavaScriptHTMLCSSAJAXAngularJSPolymerClosureGit

Tech Lead
Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Role Overview: STL Digital is seeking a talented SAP CO Consultant to join their team in Bhadrak. As a SAP CO Consultant, you will be responsible for leading or supporting SAP FICO module integrat...
Internal OrdersProduct CostingVariance AnalysisCost SheetFunctional specificationsUnit testingIntegration testingProduction supportIssue resolutionSAP CO ConsultantCost Center Accounting CCAProfit Center Accounting PCAProfitability Analysis CO

.NET Developer
FinJo Fresher Khordha 24 Sep, 2025

You are an accomplished .NET Developer with over 4 years of professional experience, responsible for designing, developing, and maintaining enterprise web applications at client project sites. You...
SQL ServerOOPSOLID principlesJavaScriptjQueryHTML5CSS3AzureAWSGitAgile methodologyNET CoreNET FrameworkASPNET MVCWeb APIEntity FrameworkEF CoreRESTful services

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Adobe AEP Developer - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bhubaneswar, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, De 24 Sep, 2025

We are currently hiring for an Adobe AEP Developer role. Please find the job details below Position - Adobe AEP Developer Location - PAN India Experie...
adobe analyticsplatformdeveloperadobeaep

Graphics Designer
Optimize For SEO Fresher Ranchi, Jharkhand 24 Sep, 2025

Job Overview Optimize For SEO is a rapidly growing company in the Digital Marketing industry, and we are currently seeking a skilled Graphics Designer professional to become a part of our team. I...
Social Media MarketingAdobe IllustratorAdobe PhotoshopCreativity

Site Civil Engineer
Floatex Solar Fresher Ranchi, Jharkhand 24 Sep, 2025

As a Site Engineer (Civil) at Floatex Solar Pvt Ltd in Tilaiya, Jharkhand, you will play a crucial role in the successful execution of projects under the guidance of the Site Incharge/Operation He...
Civil EngineeringSite EngineeringConstruction SupervisionProject ManagementBudgetingQuality ControlVendor Coordination

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Shopify Theme Developer
Akuna Technologies Fresher Mysore, Karnataka 24 Sep, 2025

The ideal candidate for this role should have a minimum of 2 years of experience in Shopify Development. You will be responsible for designing and developing custom Shopify Themes, working on both...
HTMLCSSJavaScriptShopify DevelopmentTheme DesignsLiquid TemplatesShopify App integrationsWeb design standards

Territory Sales Manager
Confidential Fresher Madurai 24 Sep, 2025

Role & Responsibilities We are looking for a Software Engineer with 3 to 6 years of experience in developing, configuring, and customizing Product Lifecycle Management (PLM) sol...
javascriptrallyautomationjirarobotseleniumgoodpycharmtestingpythonframework

Digital Marketing Specialist
Study Square Fresher Ludhiana, Punjab 24 Sep, 2025

Study Square is an international student placement consultancy providing comprehensive support to international students throughout their academic journey. From admission counseling to student vi...
SEOPPCSocial Media MarketingEmail MarketingContent MarketingDisplay AdvertisingGoogle AnalyticsAdWordsContent Management SystemsHTMLMarketing Automation Tools

Business Development Manager
Niyukti Management Consultants Hiring For Niyukti Fresher Ludhiana, ChandigarhChandigarh, Amritsar, Delhi, Noida, Karnal, Ghaziabad, Gurugram, Faridabad, Amba 24 Sep, 2025

Job Title: BDM APC (Business Development Manager APC) Agency Partner Channel Salary 3 To 7Lac Exp- Min 3 - 13 Year In...
life insurancebranch salesbusiness developmentinsurancearea sales

Urgent Requirement for offshore Jackup platform in Indonesia
Apex Offshore Services Fresher Kakinada, GunturGuntur, Nellore, Chennai, Kochi, Idukki, Bellary, Palakkad, Kollam, Thrissur 24 Sep, 2025

GREETINGS Urgent Requirement for offshore Jackup platform & Rig in Indonesia Roustabout Rigger Floorman <...
ndt levelbtech mechanical engineer

Urgent Required Roustabout For offshore RIG
Apex Offshore Services Fresher Kakinada, AnantpurAnantpur, Idukki, Karnal, Bellary, Palakkad, Kollam, Jamshedpur, Kannur, Thrissur 24 Sep, 2025

Greeting Walking interview in Mumbai . We are hiring for the position of ROUSTABOUT with a leading Oil & Gas Industry Job Responsib...
rigoffshoreoffshore platformsriggersplatformroustabout

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Executive Assistant
NARBHERAM MOTORS PRIVATE LIMITED Fresher Jamshedpur, Jharkhand 24 Sep, 2025

Role Overview: As an Executive Assistant at NARBHERAM MOTORS PRIVATE LIMITED in Jamshedpur, your primary responsibility will be to provide executive administrative support, handle expense reports,...
Executive Administrative AssistanceSchedulingVerbal CommunicationWritten CommunicationZoomExpense Reports ManagementOrganizational SkillsMicrosoft Office Suite

Executive Chef
Tiffin Box Ranchi Fresher Ranchi, Jharkhand 24 Sep, 2025

The ideal candidate for this role is a seasoned chef who will be responsible for running an efficient kitchen. Your main tasks will include continually seeking ways to enhance the menu, ensuring t...
cheffinancial managementtrainingbudget constraintskitchen operations

Rigger opening
Apex Offshore Services Fresher Jamshedpur, IdukkiIdukki, Bellary, Karnal, Kollam, Palakkad, Kannur, Thrissur, Kakinada, Anantpur 24 Sep, 2025

Greeting We are hiring for the position of RIGGERwith a leading Oil & Gas Industry Job Responsibility:

-Responsible for th...
offshore platformsriggersrigrigrgerigesrigrsplatform

Backe by DesignDgo Python Expert Senior Level
Inspire-I Solution Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Senior Python/Django Developer at our company based in Ahmedabad, India, you will be responsible for designing and building scalable backend solutions using Django, Python, and REST APIs. You...
PythonDjangoPostgreSQLMySQLOAuthGitDockerAWSGCPAzureRedisCeleryAngularREST APIsJWTCICD pipelinesReact

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Junior Finance Executive
Arbor Education Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Junior Finance Executive plays a crucial role within the finance team by supporting day-to-day operations, ensuring accuracy in financial transactions, and contributing to compliance and repor...
Financial operationsReportingComplianceIndian accounting standardsGSTTDSMS ExcelGoogle SheetsAccounting softwareAnalytical skillsWritten communicationVerbal communicationDirect tax rulesAttention to detailMonthend closingReconciliationsAud

Technical Support Engineer
Ginger Technologies Fresher Thrissur, Kerala 24 Sep, 2025

As a Technical Support Engineer at Ginger Technologies, you will play a crucial role in providing technical assistance and support to our clients. Your responsibilities will include: - Utilizing ...
Technical SkillsTroubleshootingCustomer ServiceProblem SolvingExcellent Communication Skills

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

PREV
NEXT

google cloud platform Job Openings

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers