incident response expertise jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

incident response expertise Job Openings

Showing 6301 - 6350 of 24385 Jobs

IT Health Care Recruiter

The Career Company | India Fresher Vadodara, Gujarat 24 Sep, 2025

Interviewing

Client Relationship Management

Communication Skills

Interpersonal Skills

Analytical Skills

IT Healthcare Recruiter

Recruitment Strategies

Candidate Sourcing

Postings Management

Recruitment Metrics Analysis

Industry Trends Knowledge

Power Apps/Power Automate and Power BI Expert

GLOINNT Fresher Vadodara, Gujarat 24 Sep, 2025

Power BI

SharePoint

Power Apps

Sr. Accounts Executive

Beyoungin Fresher Udaipur, Rajasthan 24 Sep, 2025

Cost Accounting

Financial Analysis

Accounting Standards

Tax Deducted at Source TDS

Manufacturing Cost Monitoring

Costsaving Strategies

Physiotherapist

Basic HealthCare Services Fresher Udaipur, Rajasthan 24 Sep, 2025

Physiotherapy

Community empowerment

Patient care

Primary healthcare

Physiotherapy training

Lead Engineer

SPENTO PAPERS (INDIA) LLP Fresher Udaipur, JaipurJaipur, Czech Republic, Ethiopia, Dominica, Agra, Dibrugarh, Varanasi, Kuwait, Rampur 24 Sep, 2025

Design Leadership & Management:

Lead and manage a team of engineers and designers within the [relevant discipline] to develop detailed designs for offsho...
offshore platformsoiloffshore oillifting operationsgaswell controllifting equipmentoffshore constructionunderbalanced drillingonshore operations

Laptop and Desktop Repair

ITSOURCE GLOBAL SERVICES PRIVATE LIMITED Fresher Pune, BangaloreBangalore, Noida, Chennai, Hyderabad, Vijayawada, Kolkata, Gurugram, Mumbai City, Del 24 Sep, 2025

React. JS Developer

Axone Infotech India Fresher Surat, Gujarat 24 Sep, 2025

HR Recruitment Manager - Manufacturing

YO IT CONSULTING Fresher Surat, Gujarat 24 Sep, 2025

human resource development

process improvement

onboarding

stakeholder management

QA Automation Engineer

Codewinglet Private Limited Fresher Surat, Gujarat 24 Sep, 2025

Selenium

Java

Mechanical Engineer ndt technician level 2 multi discpline

DESAI INDUSTRIAL INSPECTION SERVICES Fresher Surat, Gujarat 24 Sep, 2025

ndt welding inspection

Urgent requirement for Production Supervisor

sk online services Fresher Bhubaneswar, NashikNashik, Maharashtra, Odisha, Hyderabad, Nanded, Navi Mumbai, Thane, Ahmednagar, P 24 Sep, 2025

Company

Department

Location

Job Responsibil...
production managementproduction controlproductionproduction operationstestingmaterial handlingproduction planningteam leading

Sr. Office / Executive for Accounts
A1 Human Wealth Management Private Limited Fresher Cuttack 24 Sep, 2025

As a Senior Officer/Executive for Account in the Manufacturing industry based in Orissa (Cuttack), you will be reporting to the Manager of Accounts & Finance. To qualify for this position, you sho...
SAP FICODebit NoteCredit NoteFixed Asset RegisterMicrosoft OfficeGSTR1GSTR3BGSTR2A Reconciliation

Urgent requirement for Production Supervisor
sk online services Fresher Bhubaneswar, NashikNashik, Maharashtra, Odisha, Hyderabad, Nanded, Navi Mumbai, Thane, Ahmednagar, P 24 Sep, 2025

Company: Dabur India Limited Department: Production / Maintenance / Safety (based on posting) Location: In Your State Job Responsibil...
production managementproduction controlproductionproduction operationstestingmaterial handlingproduction planningteam leading

Sales Executive- Computer Showroom
Tanisha E- World Fresher Bhubaneswar 24 Sep, 2025

As a Sales Executive at Tanisha E-World, you will be a vital part of our team, specializing in high-performance PCs, laptops, gaming systems, and IT accessories. With a strong commitment to qualit...
SalesComputer HardwareCustomer ServiceRelationship BuildingPeripheralsCustomer ConsultationTechnical KnowledgeGaming SystemsSales TargetsComputer Components

Duty Medical Officer
ALTSEO PRIVATE LIMITED Fresher Bhubaneswar, BaddiBaddi, Chamoli, Gorakhpur, Kasargod, Navi Mumbai, Thrissur, Mangalore, Asansol, Cu 24 Sep, 2025

Job description

Contributing clinical expertise to patient care Performing administrative duties and risk management

Ensuring the highest standards in patient care a...
hospital medicinehospital administrationpatient administrationhealthcare compliancehealthcare managementgeneral medicinemedical operationspatient caremedical services

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Real Estate Developer
OVERNET TRADING PRIVATE LIMITED Fresher Kalahandi, DimapurDimapur, Bangalore, Bhagalpur, Chennai, Noida, Gurugram, Kolkata, Mumbai City, Zun 24 Sep, 2025

Real Estate Developers coordinate construction ability with investor needs, or they develop real estate based on customer requirements and market trends. Specific responsibilities of a Real Estat...
real estate investmentsreal estate salesreal estate constructionreal estate developmentestatereal estate - planningdeveloper

Workfront Specialist Opportunity at Capgemini - PAN India location
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bhubaneswar, BangaloreBangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, De 24 Sep, 2025

We are currently looking for a professional with strong experience in Workfront Development to join one of our clients. Please find below the key responsibilities and skill requirements for this ...
fusiondevelopment

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Raipur, BhubaneswarBhubaneswar, Cuttack, Jaipur, Sikar, Jodhpur, Kota, Udaipur, Ranchi, Bikaner 24 Sep, 2025

Machine learning engineers are responsible for putting data into machine learning models and deploying these models in production. Ingestion and preparation of data is a tricky task. It must be a...
software testingtestinghardware testingquality

Product Manager for Dust Collection System
Spark & Ray Technocrats Private Limited Fresher Raipur 24 Sep, 2025

As a highly motivated and technically proficient Mechanical or Instrumentation Engineer, you are being sought for the role of Product Manager focusing on Dust Collection Systems with specializatio...
Mechanical EngineeringInstrumentation EngineeringProduct ManagementDust Collection SystemsSolenoid ValvesCylindersTechnical SalesLead QualificationBag FiltersPulse Jet ValvesPurging ValvesPneumatic ProductsFRLsTubesFittings

Production Manager Dabur India Limited
SLN ENTERPRISES Fresher Patna, GwaliorGwalior, Indore, Jabalpur, Madhya Pradesh, Ujjain, Bhopal, Katni, Ratlam, Satna 24 Sep, 2025

Contact Person:73.03.48.90.92 ( Riya Sharma) Dabur India limited We are hiring a Production Manager managementproduction planningmanufacturingproduction managersprocess quality

Hiring For Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Pondicherry, CoimbatoreCoimbatore, Chennai, Bangalore, Bidar, Gulbarga, Vellore, Hosur, Mangalore, S 24 Sep, 2025

To ensure success as a machine learning engineer, you should demonstrate solid data science knowledge and experience in a related ML role. A first-class machine learning engineer will be someone ...
software testingtestinghardware testingquality

Area Service Incharge B
Reliance Jio Infocomm Limited Fresher Jalandhar, Punjab 24 Sep, 2025

As a Service Center Manager in our company located in Jalandhar, your role will involve: - Establishing and maintaining the upkeep of service centers - Liaising with store managers and sales team...
Team managementMarket knowledgeRelationship managementExperience in areazone for device repair operationsGeography knowledgeDelegation skillsDiversity managementDomain knowledge of telecom deviceExpertise in field repair operations

Senior 3D Artist
ChicMic Studios Fresher Punjab 24 Sep, 2025

Role Overview: You will be a skilled and imaginative 3D Artist joining our team, with a strong foundation in 3D modeling, texturing, and rendering. Your main responsibility will involve collaborat...
3D modelingtexturingrenderingBlenderMayaZbrushSubstance PainterUnreal EngineUnityMarvelous DesignerKeyshotanimationriggingMarmoset ToolbagRoblox

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Production Manager
TALENTWISE STAFFING SOLUTIONS Fresher Punjab 24 Sep, 2025

Job Description
We are hiring a Production Manager to lead our...
solarproduction planningprocess qualityproduction managersmanufacturingassembly linemanager

Shopify Theme Developer
Akuna Technologies Fresher Mysore, Karnataka 24 Sep, 2025

The ideal candidate for this role should have a minimum of 2 years of experience in Shopify Development. You will be responsible for designing and developing custom Shopify Themes, working on both...
HTMLCSSJavaScriptShopify DevelopmentTheme DesignsLiquid TemplatesShopify App integrationsWeb design standards

Anaesthesia Technician
ALTSEO PRIVATE LIMITED Fresher Mysore, BhubaneswarBhubaneswar, Ernakulam, Tiruchengode, Rudrapur, Navi Mumbai, Fatehgarh Sahib, Kat 24 Sep, 2025

An anesthesia technician assists anesthesiologists and other medical staff in preparing, maintaining, and monitoring equipment and supplies for anesthesia procedures. They play a crucial role in ...
medical terminologycardiopulmonary resuscitationpatient monitoringmedication administrationtechnical proficiencyemergency procedurespost-operative caresterilization techniquessterilization expertise

Territory Sales Manager
Confidential Fresher Madurai 24 Sep, 2025

Role & Responsibilities We are looking for a Software Engineer with 3 to 6 years of experience in developing, configuring, and customizing Product Lifecycle Management (PLM) sol...
javascriptrallyautomationjirarobotseleniumgoodpycharmtestingpythonframework

Solar PV Installation & Maintenance Trainer
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Madurai, TiruchirappalliTiruchirappalli, Thanjavur, Erode, Coimbatore, Chennai, Salem, Sivakasi, Kri 24 Sep, 2025

Job Title: Solar PV Installation & Maintenance Trainer Location: Chennai solar pvstandardsmaintenanceinstallationprotocolssafetysolarsolar project field experience

Executive - HR (Generalist)
Life Solutions Company Fresher Ludhiana, Punjab 24 Sep, 2025

As an HR Generalist at our company based in Ludhiana, you will play a vital role in managing various HR functions within the automobile industry. Your primary responsibilities will include: - Mana...
RecruitmentOnboardingHR policiesEmployee engagementGrievance handlingPerformance managementMIS reportsLabor lawsCommunication skillsInterpersonal skillsMS OfficeEmployee life cycleTrainingdevelopmentHR records managementCompliancesHR best p

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

SEO Specialist
Law Prep Tutorial Fresher Jodhpur, Rajasthan 24 Sep, 2025

You should have 2 to 6 years of experience to apply for the role of SEO Specialist at Law Prep Tutorial. As an SEO Specialist, you will be responsible for leading and implementing organic growth s...
SEOAnalytical skillsEdtechContentled SEOTechnical SEOOnpage implementationSearch intentContent hierarchySEO content frameworksSEO tools

General Practitioner
ALTSEO PRIVATE LIMITED Fresher Jodhpur, ThanjavurThanjavur, Kottayam, Imphal, Dhanbad, Pondicherry, Kolkata, Bhillai, Coimbatore, S 24 Sep, 2025

General Practitioner (GP) job description outlines the responsibilities and requirements for a physician who provides primary care, managing the health and well-being of patients across a wide ra...
medical proceduresmedical terminologyclinical pathologyemergency responsemedical practice operationsmedical transcriptionpatient careanatomy physiologyphysical examinations

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Jodhpur, UdaipurUdaipur, Jaipur, Sikar, Kota, Bikaner, Bhubaneswar, Cuttack, Raipur, Ranchi 24 Sep, 2025

Machine learning engineers are responsible for putting data into machine learning models and deploying these models in production. Ingestion and preparation of data is a tricky task. It must be a...
software testingtestinghardware testingquality

Hiring For Data Scientist
DEVIKA STAFFING SOLUTION Fresher Ranchi, PatnaPatna, Jammu, Dehradun, Mohali, Srinagar, Raipur, Navi Mumbai, Chandigarh, Vasco Da Gam 24 Sep, 2025

we rely on insightful data to power our systems and solutions. Were seeking an experienced data scientist to deliver insights on a daily basis. The ideal candidate will have mathematical and stat...
software testingtestingqualityhardware testing

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Ranchi, BhubaneswarBhubaneswar, Cuttack, Jaipur, Sikar, Raipur, Jodhpur, Kota, Udaipur, Bikaner 24 Sep, 2025

Machine learning engineers are responsible for putting data into machine learning models and deploying these models in production. Ingestion and preparation of data is a tricky task. It must be a...
software testingtestinghardware testingquality

Fire And Safety Officer
SLN ENTERPRISES Fresher Bokaro, DhanbadDhanbad, Jamshedpur, Ranchi, Chas, Saraikela Kharsawan, Giridih, Latehar, Ramgarh, Jh 24 Sep, 2025

Contact Person:73.03.48.90.92( Riya Sharma) Dear Candidate, Dabur India Ltd! We have an opportunity for the position of Safe...
safety auditsafety trainingsafety managementsafety officer activitiessafety compliancerisk assessmentincident investigation

Corporate & Business Legal Advisor
Techhansa solutions Fresher Jaipur, Rajasthan 24 Sep, 2025

As a Corporate Lawyer, your role involves utilizing your expertise in commercial law, corporate law, and business law to provide legal advice that aligns with regulatory laws while reflecting the ...
corporate lawbusiness lawlegal advicelegal researchanalytical skillsnegotiation skillscommercial law

Lead - Post Sales
Livspace Fresher Jaipur, Rajasthan 24 Sep, 2025

Role Overview: As a Lead-Post Sales at Livspace, your primary responsibility is to handle customer complaints and reconcile them according to Livspaces warranty policy. Your role plays a crucial p...
ModularHardwarePresentation SkillsInterpersonal SkillsAnalytical SkillsCustomer SatisfactionInterior ProductsCustomTechnical ExpertiseInstallation ProcessMaterials SpecificationsVerbal ArticulationWritten Communication SkillsProblemSolving Sk

Production Manager Dabur India Limited
SLN ENTERPRISES Fresher Gwalior, UjjainUjjain, Indore, Bhopal, Jabalpur, Katni, Ratlam, Satna, Madhya Pradesh, Patna 24 Sep, 2025

Contact Person:73.03.48.90.92 ( Riya Sharma) Dabur India limited We are hiring a Production Manager managementproduction planningmanufacturingproduction managersprocess quality

Manager, Branding Partnerships and Sourcing
Teach For India Fresher Ahmedabad, Gujarat 24 Sep, 2025

Working at Teach For India: Teach For India is on a journey to achieve an India free of poverty and brimming with love by eradicating educational inequity in the country. With over 15 years of exp...
BrandingPartnershipsSourcingRecruitmentBrand BuildingStrategy PlanningStakeholder EngagementPeople ManagementProcess ManagementTeam BuildingMarket ResearchStrategic PlanningCommunication SkillsOperational Excellence

Product Manager - Pharma PMT
9 Planets Placements Fresher Ahmedabad, Gujarat 24 Sep, 2025

You will be joining a dynamic team at 9 Planets Placements as a Product Manager - Pharma PMT based in Ahmedabad. In this full-time role, your primary responsibilities will include overseeing produ...
Product ManagementProduct DevelopmentMarket ResearchStrategic PlanningBusiness AnalysisRevenue GenerationMarketing StrategyCampaign ManagementRegulatory ComplianceCommunication SkillsPeople Management

Team Lead- EXIM
AP Moller - Maersk Fresher Halol, Gujarat 24 Sep, 2025

As an Export Shipment Manager at Maersk Area Office, your role is crucial in delivering on the SCM Strategy within the specified geographical area. You will be responsible for managing End-to-End ...
MS Excel

QC Manager- Building material (Wall panel, tiles, glass)
Glan Management Consultancy Fresher Ahmedabad 24 Sep, 2025

Position Overview We are seeking a dedicated and experienced QC Manager specializing in building materials, including wall panels, tiles, and glass, to join our dynamic team ...
six sigmabuilding materialqc inspectionqc tools

Frontend Developer - Reactjs
Webential Technologies Pvt Ltd Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Frontend Developer at Webential Technologies in Ahmedabad, you will be responsible for designing, developing, and implementing scalable web applications from front to back. You should have 2 ...
JavaScriptDOMGitReactjsNextjsHTML5CSSTypescriptBrowser EventsJavaScript APIsCanvas renderingBabelPostCSSWebpack

Senior Data Scientist
aloola Fresher Surat, Gujarat 24 Sep, 2025

We are looking for an experienced Senior Data Scientist to join our team at Aloola Solutions. As a Senior Data Scientist, you will be responsible for leveraging advanced analytics, machine learnin...
PythonR ProgrammingHadoopSparkTableauPower BISQLData ModelingMachine Learning AlgorithmsBig Data Technologies

Chief Executive Officer
Dhruv Corporate (HR) Solutions Pvt Ltd Fresher Ahmedabad, Gujarat 24 Sep, 2025

As the Chief Executive Officer (CEO) at the leading manufacturing company in Tanzania, specializing in a wide range of products including cement and raffia bags, flexible packaging, garments, agri...
Manufacturing processesQuality standardsProduction planningResource allocationQuality assuranceTeam managementStakeholder engagementBudgetingFinancial managementRegulatory complianceLeadershipIndustry trendsEfficiency improvementTechnical inn

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Senior Software Engineer
Neologix Software Solutions Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

You should have 3-5 years of working experience in ColdFusion 8 or higher. Your responsibilities will include designing and developing web applications using ColdFusion. It is essential that you ...
ColdFusionColdboxFuseboxMySQLXMLWeb Services

PREV
NEXT

incident response expertise Job Openings

Job Description

Position Overview We are seeking a dedicated and experienced QC Manager specializing in building materials, including wall panels, tiles, and glass, to join our dynamic team ... six sigmabuilding materialqc inspectionqc tools

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Position Overview We are seeking a dedicated and experienced QC Manager specializing in building materials, including wall panels, tiles, and glass, to join our dynamic team ...
six sigmabuilding materialqc inspectionqc tools