inventory report jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

inventory report Job Openings

Showing 3901 - 3950 of 23429 Jobs

Sales Representative

Planet Spark Fresher Pune, Navi MumbaiNavi Mumbai, Gujarat, Surguja, Gurugram, Mumbai City 28 Sep, 2025

Location: Gurgaon / Gurugram (On-site Candidate must be willing to relocate) Company: PlanetSpark About Us Pl...
business developmentcommunication skillssales processsalesdomestic salesinside salesinternational sales

Sales Engineer

Orbitouch Outsourcing Private Limited Fresher Pune, BangaloreBangalore, Gujarat, Gurugram 28 Sep, 2025

URGENT HIRING FOR ROBOT SALES ENGINEER || GURUGRAM , PUNE, BANGALORE, GUJARAT

Job Location- Gurgaon, Bangalore, Pune, Gujrat

Profile- Robot Sa...
automotive salesautomobile salesyaskawafanuc robots

Manager - Package Implementation
LTIMindtree Limited Fresher Pune 28 Sep, 2025

We are looking for talents with 6 to 7 Years Oracle Agile PLM SDK expertise Strong technical expertise and exposure to large or medium scale enterprise application integration EAI with multiple ...
OracleSaaS Technical

Sales Representative
Planet Spark Fresher Navi Mumbai, Mumbai CityMumbai City, Pune, Gujarat, Surguja, Gurugram 28 Sep, 2025

Location: Gurgaon / Gurugram (On-site Candidate must be willing to relocate) Company: PlanetSpark About Us Pl...
business developmentcommunication skillssales processsalesdomestic salesinside salesinternational sales

JD Edwards SND Consultant
LTIMindtree Limited Fresher Hyderabad, BangaloreBangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

Lift Operator
SKA Group Fresher Ghaziabad, Uttar Pradesh 28 Sep, 2025

As a Lift Operator at SKA Group in Ghaziabad, you will play a crucial role in ensuring the safe and efficient operation of elevators within our residential projects. Your primary responsibility ...
Lift OperatorOperate elevatorsMaintain cleanlinessReport technical issuesAssist residentsFollow safety protocols

Sales Representative
Planet Spark Fresher Gurugram, GujaratGujarat, Surguja, Navi Mumbai, Pune, Mumbai City 28 Sep, 2025

Location: Gurgaon / Gurugram (On-site Candidate must be willing to relocate) Company: PlanetSpark About Us Pl...
business developmentcommunication skillssales processsalesdomestic salesinside salesinternational sales

Sales Engineer
Orbitouch Outsourcing Private Limited Fresher Gurugram, BangaloreBangalore, Gujarat, Pune 28 Sep, 2025

URGENT HIRING FOR ROBOT SALES ENGINEER || GURUGRAM , PUNE, BANGALORE, GUJARAT Job Location- Gurgaon, Bangalore, Pune, Gujrat Profile- Robot Sa...
automotive salesautomobile salesyaskawafanuc robots

Analyst 3, Supply Chain Planning
Comcast Fresher Chennai, Tamil Nadu 28 Sep, 2025

Role Overview: As a Senior Supply Planner at Comcast, you will be responsible for managing inventory levels and availability, overseeing product lifecycle management, and contributing to strategic...
Inventory ManagementProduct Lifecycle ManagementData AnalysisBusiness IntelligenceAnalyticsSalesOperations Planning SOPSupplier Performance ManagementStrategic Supply Chain Planning

Business Development Manager
Skywings Advisors Private Limited Fresher Chennai, MaduraiMadurai, Kanchipuram, Namakkal, Coimbatore, Karur 28 Sep, 2025

Designation: Relationship Officer —Banca channel CTC 2 LPA Locations -Chennai,Coimbatore,Madurai,Karur,Salem,Kanchipuram,Namakal,Tirupur Only Fr...
communication skillscustomer relationship

Relationship Officer
Skywings Advisors Private Limited Fresher Chennai 28 Sep, 2025

Designation: Relationship Officer —Banca channel CTC upto 3.9LPA Locations -Chennai north and south Only BFSI and life insurance candidates can ...
bankingbanca sales

Sales Engineer
Orbitouch Outsourcing Private Limited Fresher Bangalore, GujaratGujarat, Gurugram, Pune 28 Sep, 2025

URGENT HIRING FOR ROBOT SALES ENGINEER || GURUGRAM , PUNE, BANGALORE, GUJARAT Job Location- Gurgaon, Bangalore, Pune, Gujrat Profile- Robot Sa...
automotive salesautomobile salesyaskawafanuc robots

Area Sales Manager
Skywings Advisors Private Limited Fresher Bangalore, DehradunDehradun, Hyderabad, Pune, Ahmedabad 28 Sep, 2025

Profile :- Area Sales Manager Job Role :- The Area Manager will be responsible of one state or part of a state and will report to the Regional Manager. Accomplishes sales objectives by training...
salesfield salesb2b sales

Civil Site Engineer
Ikamate HR India Pvt Ltd Fresher Ahmedabad 28 Sep, 2025

Were hiring for our Limited Company involved in Refrigeration Projects

Position: Civil Site Engineer

Location: Ahmedabad boqsite supervisionindustrial projectsindustrial engineering

Assistant Manager FMCG Company
sk online services Fresher Ahmedabad, GujaratGujarat, Baddi, Bangalore, Andhra Pradesh, Kullu, Dharamshala, Dalhousie, Bilaspur 28 Sep, 2025

Job description In case of any query, kindly connect on78,34,98,21,39 Rita Preference will be given to immediate joiners. We are looking for a skilled Assistant Manager t...
management skillsproduct trainingproject planningcustomer serviceinventoryteam leadingcommunication skillsproduct qualityleadership

Senior Surveyor
Bureau Veritas North America Fresher Ahmedabad, Gujarat 28 Sep, 2025

You will be responsible for: - Long Description 1 - Long Description 2 - Long Description 3 - Long Description 4 Qualifications required: - Relevant qualification or experience in the field If ...
SurveyingData analysisCommunicationTeamworkReport writingSenior level experienceProblemsolving

Assistant Revenue Manager
make my hotel Fresher Ahmedabad, Gujarat 28 Sep, 2025

As an intelligent job parser, here is the Job Description based on the provided details: --- **Role Overview:** You will be responsible for handling the Central Reservation Systems of Hotels lo...
SalesRevenue managementHotel managementDistribution NetworkHandling online portalsEnglish communicationYield operations

DABUR INDIA LIMITED LOCATION MP.HP.UK.PUNE
SLN ENTERPRISES Fresher Nagpur, PunePune, Nashik, Nanded, Navi Mumbai, Ratnagiri, Ahmednagar, Maharashtra, Hyderabad, Mumbai 25 Sep, 2025

Contact Person:73.03.48.90.92( Riya Sharma) Urgent Requirement store incharge for DABUR INDIA LIMITEDMANUFACTURING COMPANY JOB LOCATION : HOME LOCATION...
store managementdispatch planninginventory managementpurchasestock controlstore keepingdispatch

Area Sales Manager
Skywings Advisors Private Limited Fresher Pune, DehradunDehradun, Bangalore, Hyderabad, Ahmedabad 25 Sep, 2025

Profile :- Area Sales Manager Job Role :- The Area Manager will be responsible of one state or part of a state and will report to the Regional Manager. Accomplishes sales objectives by training...
salesfield salesb2b sales

DABUR INDIA LIMITED LOCATION MP.HP.UK.PUNE
SLN ENTERPRISES Fresher Nagpur, PunePune, Nashik, Nanded, Navi Mumbai, Ratnagiri, Ahmednagar, Maharashtra, Hyderabad, Mumbai 25 Sep, 2025

Contact Person:73.03.48.90.92( Riya Sharma) Urgent Requirement store incharge for DABUR INDIA LIMITEDMANUFACTURING COMPANY JOB LOCATION : HOME LOCATION...
store managementdispatch planninginventory managementpurchasestock controlstore keepingdispatch

DABUR INDIA LIMITED LOCATION MP.HP.UK.PUNE
SLN ENTERPRISES Fresher Nagpur, PunePune, Nashik, Nanded, Navi Mumbai, Ratnagiri, Ahmednagar, Maharashtra, Hyderabad, Mumbai 25 Sep, 2025

Contact Person:73.03.48.90.92( Riya Sharma) Urgent Requirement store incharge for DABUR INDIA LIMITEDMANUFACTURING COMPANY JOB LOCATION : HOME LOCATION...
store managementdispatch planninginventory managementpurchasestock controlstore keepingdispatch

Position Project Manager {Project Planning & Co-ordination (For TFL & NRL)
HR JOBS CONSULTANCY Fresher Noida, GhaziabadGhaziabad, Lucknow, Bangalore, Indore, Chattisgarh, Hyderabad, Kolkata, Gurugram, Ch 25 Sep, 2025

Position: ProjectManager {Project Planning & Co-ordination (For TFL & NRL) Qualification: B.E, Mechanical Experience: 15-25 Years of relevant experience. Experience in Project Planning, Schedu...
project managementproject coordination

Area Sales Manager
Skywings Advisors Private Limited Fresher Hyderabad, DehradunDehradun, Bangalore, Pune, Ahmedabad 25 Sep, 2025

Profile :- Area Sales Manager Job Role :- The Area Manager will be responsible of one state or part of a state and will report to the Regional Manager. Accomplishes sales objectives by training...
salesfield salesb2b sales

Position Project Manager {Project Planning & Co-ordination (For TFL & NRL)
HR JOBS CONSULTANCY Fresher Gurugram, GhaziabadGhaziabad, Noida, Bangalore, Indore, Chattisgarh, Hyderabad, Lucknow, Kolkata, Ch 25 Sep, 2025

Position: ProjectManager {Project Planning & Co-ordination (For TFL & NRL) Qualification: B.E, Mechanical Experience: 15-25 Years of relevant experience. Experience in Project Planning, Schedu...
project managementproject coordination

Position Project Manager {Project Planning & Co-ordination (For TFL & NRL)
HR JOBS CONSULTANCY Fresher Ghaziabad, NoidaNoida, Bangalore, Indore, Chattisgarh, Hyderabad, Lucknow, Kolkata, Gurugram, Chandi 25 Sep, 2025

Position: ProjectManager {Project Planning & Co-ordination (For TFL & NRL) Qualification: B.E, Mechanical Experience: 15-25 Years of relevant experience. Experience in Project Planning, Schedu...
project managementproject coordination

JD Edwards SND Consultant
LTIMindtree Limited Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 25 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

Immediate Opening for Milling Machine Operator
Artistic Art Forum Pvt Ltd Fresher Chennai 25 Sep, 2025

Greetings From Artistic Art Forum Pvt Ltd !! We have immediate openings for Milling Machine Operator in Chennai - Redhills Location. Role: Milling Mach...
milling machinefitters

Sas Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Pune 25 Sep, 2025

Hands on SAS experience /Advance SAS

Strong SQL knowledge and Data warehousing concepts

Support with definitions where they have not already been documented or where ...
sasmacros.developer

Electrician (Pharma Background)
Resonant Pharmaceuticals Fresher Ahmedabad, Gujarat 25 Sep, 2025

Role Overview: As an industrial electrician, you should have an ITI or Diploma in Electrical Engineering or equivalent qualification. Additionally, you should possess at least 3 years of experienc...
automation systemspreventive maintenancecorrective maintenanceequipment calibrationinventory managementindustrial electricianindustrial wiringcontrol panelsPLC operationselectrical drawingsschematicsGMP standardscleanroom operationspharmagrad

Assistant Manager FMCG Company
sk online services Fresher Ahmedabad, GujaratGujarat, Baddi, Bangalore, Andhra Pradesh, Kullu, Dharamshala, Dalhousie, Bilaspur 25 Sep, 2025

Job description In case of any query, kindly connect on78,34,98,21,39 Rita Preference will be given to immediate joiners. We are looking for a skilled Assistant Manager t...
management skillsproduct trainingproject planningcustomer serviceinventoryteam leadingcommunication skillsproduct qualityleadership

Senior Manager
BEMCON ENGINEERING PRIVATE LIMITED Fresher Ahmedabad, AnandAnand, Bharuch, Bhavnagar, Ankleshwar, Bilaspur, Amalapuram, Bhillai, Korba, Anantpu 25 Sep, 2025

Conduct market research to identify and qualify potential new customers

Segment customers cohorts and create GTM strategy based on customer requirements in these cohorts
...
strategic planningleadershipbudget management

Production Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Ahmedabad, AustraliaAustralia, Canada, Bihar, Patna, Himachal Pradesh, Kuwait, Gwalior, Indore, Bhag 25 Sep, 2025

We are looking for an experienced Production Manager to organize and oversee the manufacturing of goods. You will be ultimately responsible for the smooth running of all production lines and the ...
quality assurancemaintenanceproduct marketingproduction engineeringprocessproductionproduction management

Accounts Invoicing Executive
Munara Agro Technologies Pvt Ltd Fresher Vijayawada, Andhra Pradesh 24 Sep, 2025

The key responsibilities for this role include generating and issuing accurate customer invoices in compliance with purchase orders, delivery notes, or agreements. You will be responsible for ensu...
InvoicingERP systemRevenue recognitionAccounts receivableSales coordinationOperations coordinationReport generationAccounts InvoicingTax laws

Walking for freshers & Exp Finance, Executive,Tax,Analyst Leading Clients
Wisdom Bridge Management Consultants Fresher Vijayawada, RajahmundryRajahmundry, Srikakulam, Vizianagaram, Ongole, Kadapa, Tirupati, Vishakhapatn 24 Sep, 2025

Preparing Tentative report by collating inputs from Business Team 2 Raising customer invoices in Excel & E-invoices in Govt. portal. 3 Coordination & follow ups with process heads for billing ...
invoice processingjournal entriesbrsfinancial reportingfinancial planninggstsales entryadvanced excelaccounts payable

Walking for freshers & Exp Finance, Executive,Tax,Analyst Leading Clients
Wisdom Bridge Management Consultants Fresher Vijayawada, RajahmundryRajahmundry, Srikakulam, Vizianagaram, Ongole, Kadapa, Tirupati, Vishakhapatn 24 Sep, 2025

Preparing Tentative report by collating inputs from Business Team 2 Raising customer invoices in Excel & E-invoices in Govt. portal. 3 Coordination & follow ups with process heads for billing ...
invoice processingjournal entriesbrsfinancial reportingfinancial planninggstsales entryadvanced excelaccounts payable

Sous Chef
Tarasuns, A unit of Shree Ram Krupa Enterprise Fresher Vadodara, Gujarat 24 Sep, 2025

As a Sous Chef with a preferred background in Indian cuisine, you will be responsible for overseeing food production in all the kitchens, specifically focusing on large and multiple banquets. Your...
Indian CuisineMenu DevelopmentInventory ManagementFood ProductionVendor ManagementMenu PlanningStaff ManagementFood Cost AnalysisMarket SurveySocial Media MarketingBanquet ManagementFood Cost ControlMenu PricingHygieneSanitation Practices

Department Manager
Ikamate HR India Pvt Ltd Fresher Vadodara 24 Sep, 2025

Were Hiring: Department Manager Fashion Retail Location: Vadodara , Gujarat Experience Required: 3 to 5 years in fashion retail Salary: Up to 25k [ Based on interview performance] Role Overvi...
apparelsalesclothingfashiondepartment management

Manufacturing Materials Procurement & Inventory Management Entry Professional
Hitachi Careers Fresher Vadodara, Gujarat 24 Sep, 2025

As a Factory Buyer at Hitachi Energy in Maneja-Vadodara, India, you will be an integral part of the Transformers Business Unit (BU) team. This team is dedicated to utilizing innovative technology ...
ProcurementSupply Chain ManagementVendor ManagementInventory ManagementCost OptimizationERPSAPLean ManufacturingKANBANVMIRisk EvaluationEngineering Drawing

Retail sales/store manager (Boutique)- Female
Etalenthire Fresher Surat, JaipurJaipur, Navi Mumbai 24 Sep, 2025

Job Title: Retail Sales/Store Manager (Boutique) - Female
Annual Salary: 4,50,000 Work Location: Navi Mumbai, Jaipur, Surat Number of Pos...
boutique

Urgent requirement for Production Supervisor
sk online services Fresher Bhubaneswar, NashikNashik, Maharashtra, Odisha, Hyderabad, Nanded, Navi Mumbai, Thane, Ahmednagar, P 24 Sep, 2025

Company: Dabur India Limited Department: Production / Maintenance / Safety (based on posting) Location: In Your State Job Responsibil...
production managementproduction controlproductionproduction operationstestingmaterial handlingproduction planningteam leading

Dispatch Supervisor FMCG Company
sk online services Fresher Bhubaneswar, CuttackCuttack, Jharsuguda, Paradeep, Puri, Rourkela, Sambalpur, Balangir, Koraput, Odi 24 Sep, 2025

Job description In case of any query, kindly connect on78,34,98,21,39 Preference will be given to immediate joiners. INTERESTED CANDIDATES CAN CALL team handlingquality controlmanagement skillssite executionleadershipdispatch planning

Assistant Store Manager & Sales Assistant (Retail Stores)
Jobs Territory Hiring For Virgio Fresher Surat 24 Sep, 2025

Type: Full-time | Location: Surat Compensation: In-hand 18k-35k About the Role: Were seeking an energetic Assistant Store Mana...
stock controlcustomer servicestock replenishmentstore managementstaff schedulinginventory managementstore operationsvisual merchandising

Stock Audit Manager Retail Stores
Zion Corp Fresher Rajkot, Gujarat 24 Sep, 2025

The Stock Audit Manager is responsible for overseeing and conducting stock audits across multiple retail store locations to ensure inventory accuracy, identify discrepancies, and prevent stock los...
Analytical skillsInventory managementMicrosoft ExcelCommunication skillsProblemsolving skillsAttention to detailReporting skillsRetail stock management

Dy Manager - SCPC Buying
Mahindra Group Fresher Rajkot, Gujarat 24 Sep, 2025

You will be responsible for planning and procurement of parts for 4 platforms: LTV, MHCV, U202, W201, approximately 800 - 1000 parts per platform. Your role will involve coordinating with supplier...
Communication SkillsNegotiationRelationship ManagementConflict ManagementProcurementBenchmarkingCost ManagementCost Reduction ManagementMarket ResearchLogistics SystemsDigitizationAnalyticsSupplier DevelopmentSourcingInventory ManagementInf

Urgent requirement for Production Supervisor
sk online services Fresher Bhubaneswar, NashikNashik, Maharashtra, Odisha, Hyderabad, Nanded, Navi Mumbai, Thane, Ahmednagar, P 24 Sep, 2025

Company: Dabur India Limited Department: Production / Maintenance / Safety (based on posting) Location: In Your State Job Responsibil...
production managementproduction controlproductionproduction operationstestingmaterial handlingproduction planningteam leading

Dispatch Supervisor FMCG Company
sk online services Fresher Bhubaneswar, CuttackCuttack, Jharsuguda, Paradeep, Puri, Rourkela, Sambalpur, Balangir, Koraput, Odi 24 Sep, 2025

Job description In case of any query, kindly connect on78,34,98,21,39 Preference will be given to immediate joiners. INTERESTED CANDIDATES CAN CALL team handlingquality controlmanagement skillssite executionleadershipdispatch planning

DABUR INDIA LIMITED
SLN ENTERPRISES Fresher Bhubaneswar, CuttackCuttack, Jharsuguda, Paradeep, Puri, Rourkela, Sambalpur, Bangalore, Odisha, Him 24 Sep, 2025

Contact Person:73.03.48.90.92 ( Riya Sharma) Dabur India limited Hiring for Ware house Supervisor for one of leading FMCG company. warehouse operationsoder processinginventory managementdispatchinventory controlcommunication skillswarehouse managementsupply chain managementdistribution management

Head of Marketing
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Cuttack, AustraliaAustralia, Canada, Muzzafarpur, Guwahati, Gwalior, Chennai, Rajkot, Netherlands, A 24 Sep, 2025

Job brief We are seeking a dynamic Head of Marketing to take charge of all marketing initiatives, including social media, digital campaigns, advertising, and creative projects. As the Head o...
product developmentmarketing managementbrand managementmarketing communicationmarketing strategymarketing research

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Administrative Executive
SHRI BALAJI ENTERPRISES Fresher Bhubaneswar, BaddiBaddi, Indore, Kolkata, Jamshedpur, Pune, Mumbai City, Vadodara, Ahmedabad, Guwaha 24 Sep, 2025

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill

PREV
NEXT

inventory report Job Openings

Job Title: Retail Sales/Store Manager (Boutique) - Female

Job description In case of any query, kindly connect on78,34,98,21,39 Preference will be given to immediate joiners. INTERESTED CANDIDATES CAN CALL team handlingquality controlmanagement skillssite executionleadershipdispatch planning

Job description In case of any query, kindly connect on78,34,98,21,39 Preference will be given to immediate joiners. INTERESTED CANDIDATES CAN CALL team handlingquality controlmanagement skillssite executionleadershipdispatch planning

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ... communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill