trade show graphics jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

trade show graphics Job Openings

Showing 2401 - 2450 of 6809 Jobs

Senior Architect

Priyanka Arjun and Associates 5.00 to 9.00 Years Udaipur,Other Rajasthan 01 Apr, 2025

Hotel Sales Manager

Platinum Hotels 3.00 to 7.00 Years Udaipur,Other Rajasthan 01 Apr, 2025

market analysis

sales presentations

client relationship management

problem solving

relationship building

Export Project Manager

Pyrotech Workspace Solutions Pvt Ltd 3.00 to 7.00 Years Udaipur,Other Rajasthan 01 Apr, 2025

Creative Designer

GloVerse Labs 2.00 to 6.00 Years Udaipur,Other Rajasthan 01 Apr, 2025

Export Manager

HeyConcrete 3.00 to 7.00 Years Udaipur,Other Rajasthan 01 Apr, 2025

Export

International Trade skills

Business Planning skills

Experience in International Business

Sales

Strong negotiation

communication skills

Ability to analyze market trends

Senior Creative Designer

Midinnings 4.00 to 8.00 Years Udaipur,Other Rajasthan 01 Apr, 2025

Web / Graphics Designer

4eversolutions 2.00 to 6.00 Years Surat,Other Gujarat 01 Apr, 2025

CorelDraw

HTML

Graphic Designer- Surat Local Candidate

Cloudairy 2.00 to 6.00 Years Surat,Other Gujarat 01 Apr, 2025

Equity Dealer

SMC Global Securities Ltd 1.00 to 6.00 Years Surat,Vadodara, Ahmedabad, Ahmednagar, Solapur, Ahmednagar, Pune, Mumbai City, Jalgaon, Nagpur 01 Apr, 2025

Relationship Manager - Dealing

Maharashtra and Gujarat

equity advisorynism

Buisness Development Executive
LEXMETECH SYSTEMS PVT LTD 1.00 to 5.00 Years Bhubaneswar 01 Apr, 2025

We are looking for a talented and creative Buisness Development Executive, responsible for planning and executing on-ground marketing campaigns to increase brand awareness, generate leads, and dri...
Interpersonal skillsStrong communicationKnowledge of digital marketingCRM toolsOrganizational abilities

Assistant Manager Costumer Marketing
Diageo 2.00 to 6.00 Years Ranchi,Other Jharkhand 01 Apr, 2025

Job Title: Assistant Manager Costumer Marketing About us: With over 200 brands sold in nearly 180 countries, were the worlds leading premium drinks company. Bring your passion and use your cur...
PlanningExecutionReviewData analyticsVendor ManagementCreativityAnalyticalreasoning skillsCommunicationnegotiation skillsCollaboration skillsROI Orientation

Graphics Designer
AdPro 2.00 to 6.00 Years Ranchi,Other Jharkhand 01 Apr, 2025

Company Description AdPro offers comprehensive marketing solutions including campaign designing, market surveys, digital marketing, website designing, branding, printing services, event managemen...
Logo DesignBrandingTypographyAdobe Creative Suite

Facebook Ads Specislist
Bitsphere 2.00 to 6.00 Years Ranchi,Other Jharkhand 01 Apr, 2025

Company Description Bitsphere, founded by IIT graduates in 2016, has rapidly grown to become a leading IT services company. We specialize in Graphics Designing, Web Designing, and Digital Marketi...
Campaign ManagementData AnalysisReportingPerformance OptimizationContent CreationCopywritingDigital MarketingCommunicationTeamwork

Internship Trainee
Nexxx Advertising Pvt Ltd 0.00 to 4.00 Years Ranchi,Other Jharkhand 01 Apr, 2025

Company Description Nexxx Advertising Pvt. Ltd. is a 360-degree service provider specializing in Website Design, Graphics, Mobile Apps, and Sales activities. The companys professionals focus on u...
GraphicsInterpersonal skillsWebsite DesignMobile App developmentSales activitiesStrong communication

Graphic Cum UX/UI Designer
Ohhpro Junction 2.00 to 6.00 Years Bhubaneswar 01 Apr, 2025

Company Description Role Description This is a full-time, on-site role for a Graphic Cum UX/UI Designer located in Bhubaneswar. The Graphic Cum UX/UI Designer will be responsible for creating vi...
GraphicsGraphic DesignVideo EditingSocial MediaMarketing

Pharmaceutical Sales Representative
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 4.00 to 9.00 Years Bhubaneswar,Dehradun, Chennai, Nainital, Ghaziabad, Bathinda, Hyderabad, Pondicherry, Asansol, Namak 01 Apr, 2025

pharmaceutical sales representative job description with a concise paragraph or list of bulleted items designed to sell your workplace to applicants. Are you a large firm with big-name clients an...
pharmaceuticspharmaceutical salessales effectivenessproduct launchmarket analysismedical devicesmedical salespulmonologybusiness strategy

Agricultural Field Specialist
TEAMWORK CABLES PRIVATE LIMITED 16.00 to 25.00 Years Bhubaneswar,Rourkela, Sambalpur, Gwalior, Indore, Burhanpur, Tikamgarh, Kavaratti, Other Lakshadweep 01 Apr, 2025

Manage land-base inventory to meet operational requirements and provide strategic growth for the business

Prepare permit applications and NMPs as nee...
contract farmingagricultural productionfarmersagricultural chemicalsagricultural sciences/natural resources

Sales Marketing Executive Intern
LEXMETECH SYSTEMS PVT LTD 1.00 to 5.00 Years Bhubaneswar 01 Apr, 2025

Job Summary: We are seeking a proactive and results-driven Sales Marketing Executive to promote our products and services through on-ground marketing efforts. The ideal candidate will be responsi...
Field MarketingSalesCustomer EngagementCommunicationNegotiationInterpersonal SkillsSales StrategiesMicrosoft OfficeMarketing Principles

Graphics Designer
Qualysec Technologies Pvt Ltd 1.00 to 5.00 Years Bhubaneswar 01 Apr, 2025

Job Title :- Graphics Designer Qualysec Technologies is seeking highly motivated Graphics Designer, who will be expert in visual storytelling that engages, informs, and inspires. Were looking for...
Proven graphic designing experienceA strong portfolio of illustrationsother graphicsFamiliarity with design softwaretechnologiesA keen eye for aestheticsdetailsSolid understanding of social media platformstheir content requirementsAbility to work

Video Editor
Orange dot 2.00 to 6.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Role Description This is a full-time on-site role for a Video Editor based in Rajkot. The Video Editor will be responsible for creating and editing videos, including tasks such as video productio...
Video ProductionVideo EditingVideo Color GradingMotion Graphics

Manager - Business Development (Corporate Client Handling)
TOP CRANE SYSTEM PVT LTD 2.00 to 6.00 Years Rajkot,Other Gujarat 01 Apr, 2025

1. To Generate Market Qualified leads from various sources according to Business Generation Plan and revenue target Sources: Web Browsing , Directories of association, B2B Portal etc. 2. To Entert...
ProspectingObjection handlingNegotiation skillsMIS preparationMarket researchMarket Qualified leads generationSuspectingClient requirement analysisTechnocommercial presentationSales funnel managementSales tour planningFunctionalmanagerial upgr

Graphic Designer & Video Editor
Unboxx Digital Media 2.00 to 6.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Company Description Welcome to Unboxx Digital Media, a creative digital marketing agency based in Rajkot. We are focused on social media management, brand identity design, content creation, socia...
Adobe PhotoshopAdobe IllustratorAdobe IndesignAdobe After EffectsCoreldrawAdobe Premier ProGraphicsGraphic Design skillsLogo DesignBranding expertiseProficiency in TypographyExperience in video editingproductionKnowledge of social media trend

Retail Cluster Head
Kanhai Foods Ltd (Kabhi-B) 3.00 to 7.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Retail Cluster Head Kabhi B Bakery About Kabhi B Bakery: Since 1996, Kabhi B (Kanhai Foods Ltd) has been setting new benchmarks in the bakery industry with innovative and high-quality products....
Retail OperationsFranchise ManagementStore OperationsCustomer ExperienceLeadershipTeam ManagementPL Management

Accounts and International Trade Executive
ASQUARE EXPORT HOUSE 2.00 to 6.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Company Description ASQUARE EXPORT HOUSE is a well-established exporter of high-quality borehole drilling rigs and spare parts, based in India. Specializing in exports to Middle East & African C...
Analytical skillsCommunication skillsNegotiation skillsMS OfficeAccounting SoftwareAccounts ManagementInternational Trade OperationsImportExport regulations

Sales Manager ( Sheet Metal Industry)
The Talent Quest Centre 5.00 to 9.00 Years Raipur 01 Apr, 2025

Sales Manager Vacancy with the largest manufacturer of Bulk Conveying Chains and Accessories in India established in the year 1978 and having exports to over 35 countries around the world, includi...
Market ResearchRelationship ManagementTrade ShowsComplianceMarketing StrategiesSales Collaboration

Graphics Designer
Bits World iTech 2.00 to 6.00 Years Raipur 01 Apr, 2025

Company Description Bits World iTech is a consultant in Information Technologies based in Raipur. We offer services including website designing, software development, digital marketing, sales/sup...
PhotoshopIllustratorCanvaGraphicsGraphic Design skillsLogo DesignBranding skillsTypography skillsKnowledge of design principlestrendsExcellent communication

US Accounting Associate
Fundtec 3.00 to 7.00 Years Raipur 01 Apr, 2025

US Accounting (Semi Qualified CA or CMA) Overview - You will be responsible for assisting Auditors and Accountants in essential accounting functions. You will also be responsible for preparing i...
AccountingBookkeepingFinancial reportingTax returns preparationClient accounts managementFinancial records analysis

YouTube Video Editor
Scrollwell 1.00 to 5.00 Years Patna,Other Bihar 01 Apr, 2025

Company Description Founded in 2020, Scrollwell drives educational change by offering live training to strengthen educators for digital success in Patna. The company is supported by Startup India...
Video ProductionVideo EditingVideo Color GradingMotion Graphics

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Patna,Bhagalpur, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Delhi, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Relationship Manager Wealth
Waytogo Consultants Pvt Ltd 2.00 to 7.00 Years Pune,Mumbai City, Ahmedabad 01 Apr, 2025

- Profile involving acquiring, growing and deepening HNI Banking customer relationships through effective relationship management. - Focusing on the analysis and satisfaction of HNI Customers- ...
hni client handlingwealth managementhni acquisition

Relationship Manager-Equipment Finance-Sales(Digital)-Nagpur - Narang Towers- JM
Tata Capital 2.00 to 6.00 Years Nagpur,Other Maharashtra 01 Apr, 2025

11095 1. Originate NTB prospects through direct sourcing and open market channels 2. Acquiring customers and taking their proposal up to the stage of disbursement. 3. Meeting existing customers t...
Customer AcquisitionBusiness DevelopmentRevenue GenerationWorking Capital ManagementCustomer Relationship ManagementCross SellingDirect SourcingSales Queries HandlingNew Business Opportunities Identification

Video Editor
SoulPlus 2.00 to 6.00 Years Nagpur,Other Maharashtra 01 Apr, 2025

Company Description Soul is Central Indias Exclusive Wellness Sanctuary, bridging seekers and facilitators through transformative experiences in personal growth, emotional well-being, and fitness...
Video ProductionVideo EditingVideo Color GradingMotion GraphicsGraphicsAdobe Premiere ProFinal Cut ProDaVinci ResolveAudio Editing

Executive - Import Export
TEAMWORK CABLES PRIVATE LIMITED 16.00 to 25.00 Years Mangalore,Chennai, Ramanagara, Kolar, Bangalore, Bangalore Rural, Chikkaballapur, Nelamangala, Chama 01 Apr, 2025

Roles and Responsibilities of an Export Executive

Research, develop, and manage export business plans, trade agreements and export strategies.

Ensure comp...
executive team alignmentexecutive productionexecutive supportexecutive management

Divisional Manager
TEAMWORK CABLES PRIVATE LIMITED 16.00 to 25.00 Years Mangalore,Chennai, Bangalore, Other Karnataka, Malappuram, Kottayam, Kozhikode, Kasargod, Thiruvanan 01 Apr, 2025

The Division Manager plays a vital role in overseeing and managing the operations of an entire division within the company. This position requires a blend of strategic oversight, operational manag...
foreign assistanceindustrial policymanagerial economicstrade negotiationoperating agreementsindustrial economicstrade agreementsdivision ordersmanager

Equity Dealers
QRN Services 1.00 to 5.00 Years Mangalore,Chennai, Bangalore, Hubli 01 Apr, 2025

locations: Bangalore, Mangalore, Hubli, Hosur, Chennai, Company: A reputed broking firm Position:Equity Dealer Prime Responsibility Revenue generation from dealing & Other Product & Services ...
revenue generationshare marketclient acquisitionnismequitysecurities tradingmututal fundfinancial market

Branch Manager
QRN Services 4.00 to 8.00 Years Mangalore,Bangalore, Hubli, South Goa 01 Apr, 2025

Position:Branch Manager Company : Reputed broking firm Locations : Bangalore, Hubli, Mangalore, Margao Prime Responsibility Managing Branch as Profit Center by revenue generation across all Pro...
mutual fundsnismequity tradingbranch operationsbrokingstock markethni client handlingrevenue generationamfi

Presentation Specialist Trainee
Hiring Squad Hiring For Hiring squad 0.00 to 1.00 Years Mumbai City 01 Apr, 2025

Key Responsibilities:

Be a part of the team working on producing PowerPoint presentations, Word and Excel templates for our global client.

Work on creating h...
presentation designpowerpointwordms officepresentation skillsexcel powerpoint

Videographer
Crazy Fox Creations 1.00 to 5.00 Years Lucknow,Other Uttar Pradesh 01 Apr, 2025

Join our Team as a Videographer at Lucknow Office CrazyFox Creations is looking for talented videographers to join our creative team in Lucknow. As our video demand is growing, we are looking fo...
videographyvideo productionmotion graphicsFCPAdobe Premierepostproductionsoundlighting equipment

Opening for Evaluator (Used Cars) in Lucknow
Reema Rai 1.00 to 6.00 Years Lucknow 01 Apr, 2025

At present we are having urgent positions forEvaluator (Used Cars)with one of our reputed clients in used cars in Lucknow location.

Company profile ...
estimationestimatorsfour wheelerevaluationused cars

Fresher Video Editor
Flymedia Technology Ludhiana 0.00 to 4.00 Years Ludhiana,Other Punjab 01 Apr, 2025

Job Title: Video Editor (Fresher) Location:- Ludhiana Job Type: [Full-time/Internship] Experience: (Freshers can apply) Job Summary: We are looking for a creative and detail-oriented Video Edito...
Video EditingAdobe Premiere ProFinal Cut ProDaVinci ResolveVisual EffectsCommunication SkillsTeamwork

Video Editor
High Dive International 2.00 to 6.00 Years Ludhiana,Other Punjab 01 Apr, 2025

Role Description This is a full-time, on-site role for a Video Editor located in Ludhiana East. The Video Editor will be responsible for producing, editing, and color grading video content. Addit...
Video ProductionVideo EditingVideo Color GradingMotion Graphics

Sales Manager
Power Jobs 4.00 to 9.00 Years Ludhiana 01 Apr, 2025

Dear Candidate
We are seeking an experienced and dynamic Sewing Machine Sales Manager to oversee and expand our distributor network. The ideal c...
general tradesales

Fitter and Turner
Worth Peripherals Limited 3.00 to 7.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

We are looking for a skilled and experienced Fitter and Turner to join our mechanical maintenance team. The ideal candidate will be responsible for the repair, maintenance, and fitting of mechanic...
FittingTurningMaintenanceRepairAlignmentPreventive maintenanceSafety complianceInstallationCommissioningWeldingHydraulicsPneumaticsMechanical componentsPrecision fittingLathe operationMilling operationGrinding operationReading technical d

Purchase Manager - Sec 43, Gurgaon ( Food Industry Experience )
Alpha Pro Services Hiring For Alpha Pro Services 1.00 to 6.00 Years Gurugram 01 Apr, 2025

Position - Purchase Manager - Male Location:Sec 43, Gurgaon Job Responsibilities :- Research potential vendors. Compare and evaluate offers f...
procurementvendor managementpurchasefood

Video Editor - Advertising Agnecy
MEGMA SERVICES 2.00 to 4.00 Years Gurugram 01 Apr, 2025

ob description

Responsible for managing multiple video projects simultaneously. This includes understanding project requirements, establishing timelines and deadlines....
adobe premiere pro2d animationadobe photoshopmotion graphicsadobe after effectscameravideoadobe illustratortrackingeditor

E-commerce Account Managment Lead - CBT (Cross Border Trade)
ACUITTY CONSULTANTS LLP Hiring For AcuittyTech 1.00 to 2.00 Years Gurugram 01 Apr, 2025

Key Responsibilities: As an e-commerce account manager, you will work with one of the worlds largest companies to guide their partners ( business-to-businesskey account managementaccountabilitycommunication skillsexport import documentationrelationship buildingms excele-commerce account managementproduct listing

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

PCB Layout Design Engineer
RIOD LOGIC PRIVATE LIMITED 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Job Overview: A PCB Layout Design Engineer is responsible for designing and developing printed circuit board (PCB) layouts to meet electrical, mechanical, and manufacturing requirements. The role...
PCB designAltium DesignerCadence AllegroOrCADSignal integrityPower integrityThermal analysisBill of MaterialsDFMDFT3D modelingPower distributionPCB layoutMentor GraphicsGerber filesIPC standardsEMIEMC guidelinesDesign reviewsRF PCB layou

PREV
NEXT

trade show graphics Job Openings

Roles and Responsibilities of an Export Executive Research, develop, and manage export business plans, trade agreements and export strategies. Ensure comp... executive team alignmentexecutive productionexecutive supportexecutive management

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Roles and Responsibilities of an Export Executive

Research, develop, and manage export business plans, trade agreements and export strategies.

Ensure comp...
executive team alignmentexecutive productionexecutive supportexecutive management