cloud implementation jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

cloud implementation Job Openings

Showing 5751 - 5800 of 24329 Jobs

SAP MM testing

CYANOUS SOFTWARE PRIVATE LIMITED Fresher Hyderabad, BangaloreBangalore, Chennai 25 Sep, 2025

SAP MM testing

5 - 7 years of experience

SAP Testing-L3
Expertise in SAP MM Material Management-L3
Expertise in SAP Retail...
testingsap

Adobe Analytics(dashboardSQL)

LTIMindtree Limited Fresher Hyderabad 25 Sep, 2025

Adobe Campaign

SailPoint IIQ Senior Developer

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Gurugram, DelhiDelhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 25 Sep, 2025

devops

sailpoint

sql

Technical Architect Associate

Chetu India Pvt Ltd Fresher Noida 25 Sep, 2025

Job Summary

SailPoint IIQ Senior Developer

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 25 Sep, 2025

devops

sailpoint

sql

Senior Software Engineer 2

C3 India Delivery Centre LLP (formerly known as Crowe Horwath IT Services LLP) Fresher Noida, Uttar Pradesh 25 Sep, 2025

Microsoft technology stack

Senior Software Development Engineer 2

SBS Fresher Noida, Uttar Pradesh 25 Sep, 2025

Digital transformation

Agile methodologies

Microservices architecture

Reactive programming

Enterprisegrade components

JD Edwards SND Consultant

LTIMindtree Limited Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 25 Sep, 2025

jde - distribution

jde

ServiceNow SAM ITAM

MNR Solutions Pvt Ltd Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Pune, Delhi 25 Sep, 2025

servicenow

it asset management

itam

SAP Work Manager Developer

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

Adobe Analytics(dashboardSQL)

LTIMindtree Limited Fresher Chennai 25 Sep, 2025

Job Description

Adobe AnalyticsCampaign

Sales Development Representative

Live Connections Fresher Bangalore 25 Sep, 2025

business

sales development

sales department processes

Sr. Data Engineer (Azure Synapse)

Versent Systems Ltd Fresher Ahmedabad, Gujarat 25 Sep, 2025

Azure data engineering

Data technology

Data platform solutions

Presales Architects

Cloud Engineers

Azure data services

Problemsolving skills

Data pipelines

File f

MERN Stack Developer

Arihant HR Consultancy Fresher Ahmedabad 25 Sep, 2025

Develop and maintain end-to-end applications using MongoDB, Express.js, React.js, and Node.js.
Convert Figma/UI designs into responsive and interactive i...
restful apisawsnode.jsresponsive web designreact.jsexpress.js

French Language Expert

IMPLEO CONSULTING Hiring For Impleo consulting Fresher Ahmedabad, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Chandigarh, Mumbai City, D 25 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY

What we are looking for & job description:

Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

French Language Expert
IMPLEO CONSULTING Hiring For Impleo consulting Fresher Ahmedabad, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Chandigarh, Mumbai City, D 25 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY WORK FROM HOME { AS PER BUSINESS REQUIREMENT VOICE PROCESS } What we are looking for & job description: Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

Backend .NET Developer
AppleTech Fresher Vadodara, Gujarat 24 Sep, 2025

As a Web Application Developer at AppleTechSoft, you will be required to have a minimum of 5 years of hands-on experience in developing web applications on the Microsoft Windows Platform and cloud...
Software DesignArchitectureREST APIOODAOPSQL ServerSQL QueriesJOINSDatabase DesignLINQDebuggingAnalytical SkillsJAVASCRIPTDOJODockerMicrosoft TechnologiesVerbal CommunicationWritten CommunicationMicrosoft Windows PlatformCloud Technolog

Hiring For Chemical Engineer
DEVIKA STAFFING SOLUTION Fresher Vadodara, SuratSurat, Bhavnagar, Rajkot, Chennai, Hyderabad, Vijayawada, Vishakhapatnam, Pune, Coimb 24 Sep, 2025

We are seeking a talented Chemical Engineer to join our team and contribute to the implementation, analysis, and improvement of processes and equipment within our organizations plants. As a Chemi...
maintenancequalityresearch

Machine Learning Engineer
Sunflower Lab Fresher Vadodara, Gujarat 24 Sep, 2025

As a Machine Learning Engineer, you will be responsible for designing and implementing scalable machine learning models throughout the entire lifecycle - from data preprocessing to deployment. You...
PythonNumPySparkPandasScikitlearnTensorFlowPyTorchMLflowKubeflowDaskAWS SageMakerGCP AI PlatformWeightsBiasesDVCRay

Physiotherapist
Basic HealthCare Services Fresher Udaipur, Rajasthan 24 Sep, 2025

Inviting professionals from the field of Physiotherapy and a passion to serve rural and underserved areas to work with Basic Healthcare Services, as a Physiotherapist at AMRIT Clinics in Salumbar ...
PhysiotherapyCommunity empowermentPatient carePrimary healthcarePhysiotherapy training

MERN Full Stack Developer
Xcellence-IT Fresher Surat, Gujarat 24 Sep, 2025

You will be joining a dynamic and forward-thinking IT solutions company, Xcellence-IT, as a MERN Full Stack Developer. In this role, you will be responsible for designing, developing, and maintain...
JavaScriptHTML5CSS3MongoDBRESTful APIsWeb servicesAWSAzureMochaMERN stackExpressjsReactjsNodejsVersion control systemsAgile development methodologiesTypeScriptGraphQLCICD

Senior React.js Developer
Inventam Tech Solution ( OPC ) Fresher Surat, Gujarat 24 Sep, 2025

As a Senior React.js Developer at our innovative IT services company specializing in cutting-edge software solutions, you will be at the forefront of developing an advanced finance and trading app...
JavaScriptHTML5CSS3WebSocketsAWSAzureReactjsTypeScriptReduxMobXContext APIMaterial UIAnt DesignNextjsD3js

Node.js Developer
R K Infotech Fresher Rajkot, Gujarat 24 Sep, 2025

As a Node JS Developer at our dynamic and fast-paced team dedicated to driving digital transformations, your role will involve: - Strong proficiency with JavaScript - Knowledge of Node.js and var...
JavaScriptHTMLCSSAJAXAngularJSPolymerClosureGit

Tech Lead
Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Role Overview: STL Digital is seeking a talented SAP CO Consultant to join their team in Bhadrak. As a SAP CO Consultant, you will be responsible for leading or supporting SAP FICO module integrat...
Internal OrdersProduct CostingVariance AnalysisCost SheetFunctional specificationsUnit testingIntegration testingProduction supportIssue resolutionSAP CO ConsultantCost Center Accounting CCAProfit Center Accounting PCAProfitability Analysis CO

.NET Developer
FinJo Fresher Khordha 24 Sep, 2025

You are an accomplished .NET Developer with over 4 years of professional experience, responsible for designing, developing, and maintaining enterprise web applications at client project sites. You...
SQL ServerOOPSOLID principlesJavaScriptjQueryHTML5CSS3AzureAWSGitAgile methodologyNET CoreNET FrameworkASPNET MVCWeb APIEntity FrameworkEF CoreRESTful services

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Workfront Specialist Opportunity at Capgemini - PAN India location
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bhubaneswar, BangaloreBangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, De 24 Sep, 2025

We are currently looking for a professional with strong experience in Workfront Development to join one of our clients. Please find below the key responsibilities and skill requirements for this ...
fusiondevelopment

Hiring For Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Patna, BhagalpurBhagalpur, Gopalganj, Bihar, Mohali, Bokaro, Dhanbad, Korba, Solan, Raigarh 24 Sep, 2025

We are actively searching for a talented and experienced Machine Learning (ML) Engineer to join our team. As a Machine Learning Engineer, you will play a crucial role in the development and imple...
testingsoftware testinghardware testingmanual testing

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Business Process Optimization Manager
University of the People Fresher Mysore, Karnataka 24 Sep, 2025

As a Business Process Optimization Manager at University of the People (UoPeople), you will be responsible for leading and managing the optimization of business processes across the organization. ...
Business Process OptimizationProcess ImprovementLeadershipLeanSix SigmaBPMData AnalysisProject ManagementCommunication SkillsInterpersonal SkillsStrategic ThinkingAnalytical Abilities

Alliance Executive
Taggd Fresher Ludhiana, Amritsar 24 Sep, 2025

Role & responsibilities

Executing tie-ups, Promotional Activities, and events in up metro markets.

Develop marketing initiatives to expand customer base and...
btl activationalliance managementoffline marketing

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Partner Service Manager
Strada Global Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: Join Strada on a journey of endless possibilities where unlocking potential for every colleague is the foundation of everything they do. With the support, resources, and opportuniti...
Change managementMS Office toolsInfluencing skillsDelivery modelsAttention to detailWritten

Field Sales Executive - BFSI
Sarika HR Solutions Fresher Kochi, Chennai 24 Sep, 2025

Job Purpose To offer customized insurance solution to the customers for all their financial needs and act as an interface between customer and company Responsibilities To direct sell to the cu...
banking salessellingfieldfield salessalesinsurance brokeragebankinginsurance salesinsurancefield collectionslife insurancestreet

SEO Specialist
Law Prep Tutorial Fresher Jodhpur, Rajasthan 24 Sep, 2025

You should have 2 to 6 years of experience to apply for the role of SEO Specialist at Law Prep Tutorial. As an SEO Specialist, you will be responsible for leading and implementing organic growth s...
SEOAnalytical skillsEdtechContentled SEOTechnical SEOOnpage implementationSearch intentContent hierarchySEO content frameworksSEO tools

Hiring For Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Bokaro, DhanbadDhanbad, Patna, Bihar, Bhagalpur, Mohali, Gopalganj, Korba, Solan, Raigarh 24 Sep, 2025

We are actively searching for a talented and experienced Machine Learning (ML) Engineer to join our team. As a Machine Learning Engineer, you will play a crucial role in the development and imple...
testingsoftware testinghardware testingmanual testing

Executive Chef
Tiffin Box Ranchi Fresher Ranchi, Jharkhand 24 Sep, 2025

The ideal candidate for this role is a seasoned chef who will be responsible for running an efficient kitchen. Your main tasks will include continually seeking ways to enhance the menu, ensuring t...
cheffinancial managementtrainingbudget constraintskitchen operations

Backe by DesignDgo Python Expert Senior Level
Inspire-I Solution Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Senior Python/Django Developer at our company based in Ahmedabad, India, you will be responsible for designing and building scalable backend solutions using Django, Python, and REST APIs. You...
PythonDjangoPostgreSQLMySQLOAuthGitDockerAWSGCPAzureRedisCeleryAngularREST APIsJWTCICD pipelinesReact

French Language Expert
IMPLEO CONSULTING Hiring For Impleo consulting Fresher Ahmedabad, GurugramGurugram, Mumbai City, Bangalore, Noida, Hyderabad, Kolkata, Pune, Chandigarh, De 24 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY WORK FROM HOME { AS PER BUSINESS REQUIREMENT VOICE PROCESS } What we are looking for & job description: Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Site Reliability Developer 4
Oracle Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Network Reliability Engineering (NRE) team at Oracle Cloud is responsible for ensuring the robustness of the Oracle Cloud Network Infrastructure. As a Network Reliability Engineer, your primar...
Network EngineeringMPLSBGPIPv6DNSDHCPSSLData Center designPythonScriptingAutomationNetwork monitoringNETCONFVxLANEVPNTelemetry solutionsYANG

Python / Gen AI Developer
LION AND ELEPHANTS CONSULTANCY PRIVATE LIMITED Fresher Erode, CoimbatoreCoimbatore, Chennai, Tambaram, Pudukottai, Dindigul, Namakkal, Kumbakonam, Bangalor 24 Sep, 2025

Job Overview: We are looking for an experienced and passionate Python/Gen AI Developer to join our team in Coimbatore. The ideal candidate will have strong expe...
pythoncloud awsartificial intelligencedjangoflaskllmsgenerative ailanggraphpyspark

bank audit manager
PSS Consultant Fresher Coimbatore, PondicherryPondicherry, Chennai, Bangalore, Madurai, Erode, Kochi, Ernakulam, Thiruvanan 24 Sep, 2025

Pss Consultant Hiring For Banking bank audit managerDescription A bank audit manager plans, leads, and supervises audit engagements t...
banking operationssupervise implementationinternal auditcompliance

Opportunity for Network Engineer Role in Coimbatore
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Coimbatore 24 Sep, 2025

We have an opening for a Network Engineer role based in Coimbatore. Please find the key details below: Experience: 4 to 12 years Location: Coimbatore Role Overview: This position involves L2 ...
wannetwork administration

PREV
NEXT

cloud implementation Job Openings

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers