complaint investigation jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

complaint investigation Job Openings

Showing 51 - 100 of 1890 Jobs

**reputed company Outbound Customer Service Representative (Remote) Coverage

remote zest jobs 1.00 to 10.00 Years All India 17 Aug, 2026

customer service

team building

verbal communication

written communication

coverage specialist

remote work

attorney management

customer service standards

phone sales

Hiring for Quality Engineer

VGS Services Hiring For corporate company 1.00 to 10.00 Years Pune, Navi Mumbai 14 Aug, 2026

engineering

process manufacturing

Service CRM

Vimuktaye Solutions Hiring For AMO 1.00 to 10.00 Years Noida 14 Aug, 2026

We are hiring for well known manufacturing company .

Profile - Service CRM

Experience - Minimum 6 months

Qualifications - Graduation(...
callingms officecommunication skills

Safety Officer
AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Ethiopia, Bangladesh, South Africa, Bangalore, Chennai, Noida, Nepal, Hyderab 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Safety Officer
AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Gurugram, DelhiDelhi, Noida, Ethiopia, Bangladesh, South Africa, Bangalore, Chennai, Nepal, Hyderaba 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Safety Officer
AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Chennai, EthiopiaEthiopia, Bangladesh, South Africa, Bangalore, Noida, Nepal, Hyderabad, Kolkata, Un 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Customer support Executive Real Estate group(Moshi)
Tulip Group 1.00 to 10.00 Years Pune 06 Aug, 2026

We are seeking a dedicated and customer-focused Customer Support Executive to join our Real Estate Group. The role involves handling customer queries, managing property-related documentation, ensu...
Customer serviceCommunicationSales supportRelationship managementDocumentationMIS reportingCRM systemsComplaint resolution

Cluster Medical Director Mumbai
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Mumbai City 06 Aug, 2026

1. Clinical Governance & Operational Leadership Provide overarching clinical leadership, administrative supervision, and operational direction to all Medical Officers, nurses, and paramedical st...
clinical governancepediatricsgynecologyleadership

Sr. Service Engineer
ETHOS HR MANAGEMENT AND PROJECTS LIMITED 1.00 to 10.00 Years Ahmedabad 06 Aug, 2026

Key Responsibilities

Plan and schedule installation and commissioning activities, and allocate manpower based on project complexity.

Ensure availability of t...
customer supportdrawingmachine maintenancecommissioninginstallationdocumentationmachinerygeneralarrangement

REQUIRED SAFETY SUPERVISOR DABUR INDIA LIMITED
SUMIT KUMAR NEGI 1.00 to 10.00 Years Nagpur, PunePune, Nashik, Nanded, Navi Mumbai, Thane, Maharashtra, Bhubaneswar, Bokaro, Jharkhand 03 Aug, 2026

Contact Person :87,96,58,83,40 Rita Mam
Safety Supervisor Dabur India Limited (Job Description)
safetyregulatory complianceemergency responsesafety officer activitiesrisk managementsafety managementsafety trainingcommunicationsafety audit

Guest Relations Executive
BHARTI HR CLEANER WALA ZEEVIKA JOBS Hiring For Aamrapaali Group 1.00 to 10.00 Years Lucknow 03 Aug, 2026

Urgent Hiring | Guest Relation Executive | Lucknow | 1-4 Years | Upto 20000 Salary

Job Summary We are looking for a dynamic, customer-focused, and professional Guest Relatio...
communicationcustomer relationshipguest relationsguest servicecustomer servicehotel operationsreceptionguest handling

Returnship - TM-Claims HC
Cognizant 1.00 to 10.00 Years Kochi 03 Aug, 2026

Job Summary Serve as a senior claims subject matter expert within a hybrid work model night shift environment applying deep knowledge of HIPAA claims adjudication and both provider and payer ope...
provider relationscustomer experienceuser acceptance testingHIPAA claims adjudicationproviderpayer operationshealth care claims processingHIPAA regulationsprovider reimbursement methodologiespayer domain expertise

Remote Senior Operations Analyst Data-Driven Insights & Resource Planning
remote next 1.00 to 10.00 Years All India 01 Aug, 2026

Join arenaflex Where Data Meets Innovation in the Travel Industry Are you reputed company to be part of a dynamic team thats transforming how a global leader serves millions of customers arenafle...
SQLPythonTableauanalytical skillscommunication skillsMS Officedata visualizationstatistical analysisproject management

Auditing Mgr- CS
MEGMA SERVICES 1.00 to 10.00 Years Mumbai City 31 Jul, 2026

Leading Financial services company requires Deputy Mgr/Mgr (Auditing and compliance)- - Mulund-Mumbai ( Only company secretary qualified need apply) One of our client a leading Financial servic...
company secretarial functionscompany secretarial workamalgamationcompanies actsebi regulations

Walkin drive for Fraud Analyst
HCL Technologies Ltd 1.00 to 10.00 Years Bangalore 31 Jul, 2026

HCLTech | Walk-In Drive | Fraud Analyst | 1st Aug 26 | Bangalore Date: 1st Aug 26 (Saturday) Timing:<...
fraud analysisfraud investigationfraud managementfraud controlfraud detection

Fire & Safety Supervisor Dabur India Limited
SUMIT KUMAR NEGI 1.00 to 10.00 Years Patna, BiharBihar, Bhubaneswar, Cuttack, Bangalore, Chattisgarh, Rudrapur, Haldwani, Bhillai, Haridw 28 Jul, 2026

Contact Person :97,17,22,36,28 Renu Mam
Urgent Requirements Post - fire and Safety Supervisor Expe...
safety auditfire fightingsafety officer activitiessafety trainingsafety engineeringsafety case developmentsafety implementationfire safety

Liaison Officer
TRUE BUDDY CONSULTING PVT LTD 1.00 to 10.00 Years Noida, DelhiDelhi, Faridabad, Ghaziabad, Dharwad, Bellary, Gurugram 28 Jul, 2026

Job Description Executive Action & Liaison Location:PAN INDIA Experience: 1-5 Years Industry: Investigation / Risk Managemen...
due diligenceintelligence gatheringfield investigationsrisk managementgovernment liaison

Urgent | Health Claim Facilitator | Mumbai
Shree Balaji Employment Services Pvt Ltd 1.00 to 10.00 Years Mumbai City 28 Jul, 2026

We Are Hiring Health Claim Facilitator Location: Mumbai Key Responsibilities:

Managed cashless and reimbursement health insurance c...
visitclaim investigationfield work

Assistant Manager - Application Security
knowledge Artisan 1.00 to 10.00 Years Kochi 28 Jul, 2026

Were Hiring : Assistant Manager Application Security, IT Audit & GRC (2 Positions) Location : Kochi, Kerala Work Mode : On-site Employment Type : Full-Time Salary : Not a constraint for ...
Application SecuritySecure SDLCVAPTVulnerability ManagementGRCRisk ManagementSecurity ToolsIT Security AuditsERPApplication Security Reviews

Fraud Analyst AML KYC Banking Operations Chargebacks 1PlusYrs | Hyd
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Hyderabad 28 Jul, 2026

Job Description (JD) Fraud Analyst | AML/KYC | Banking Operations Location: Hyderabad Experience: 14 Years CTC: Up to 4 LPA Shift: US Rotational Shift Notice Period: Immediate to 15 Days Pref...
Fraud InvestigationFraud DetectionAMLAnti Money LaunderingKYCFraud AnalystFraud Operations

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Surat, KochiKochi, Rudrapur, Pune, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Noida, DelhiDelhi, Lucknow, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Inventory Control Manager
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Meerut, MoradabadMoradabad, Ghaziabad, Lucknow, Varanasi, Firozabad, Faizabad, Agra, Hyderabad, Kolk 22 Jul, 2026

An Inventory Control Manager team supervisiondatatechnicalanalysistime managementanalyticalforecastingskills

For Team Leader Manager
The Bombay Skin Clinic 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

*Job Title: Team Leader Manager* *Lo...
escalation managementteam handlingteam managementteam leadingcommunication skillscustomer services manager

Vacancy For Customer Services Manager
The Bombay Skin Clinic 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Hiring Customer Service Manager | The Bombay Skin Clinic Location: Lower Parel Employment Type: Full-time Key Responsibilities...
complaint handlingteam handlingpatient relationship managercustomer services managerlead follow-up

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Sales Manager HoReCa & Distribution
Team HR GSA Private Limited 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Job Brief: Sales Manager (HoReCa & Distribution) Company: Aroma Spices Industry: Food & Beverages (Spices, Seasonings, and Food Service Solutions) Target Segment: HoReCa (Hotels, Restaurants, ...
fmcg marketingfmcg sales

Safety Officer
A-ONE STAFFING 1.00 to 10.00 Years Lucknow, AngulAngul, Kollam, Ranchi, Panipat, Coimbatore, Durgapur 22 Jul, 2026

Urgent Requirements Post - Safety Officer Experience - 1yr to 4yr Salary - 22,000 to 38,000 Facility - Living Traveling Canteen Location - Kollam, Lucknow, Ranchi,...
safety inspectionsafety trainingsafety officer activitiessafety auditsafety engineeringsafety analysis

SOC & NOC Analyst
Muthoot Microfin 1.00 to 10.00 Years Kochi 22 Jul, 2026

Role & responsibilities Monitor alerts generated by SOC and NOC tools. Perform first-level analysis and ticket creation. Escalate incidents based on defined procedures. Monitor server, network...
Network Monitoring ToolsBasic NetworkingWindowsLinux FundamentalsSecurity Monitoring ConceptsEndpoint Security ToolsIncident Ticket ManagementBasic Cloud ConceptsCybersecurity FundamentalsSIEM Monitoring

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Kochi, RudrapurRudrapur, Pune, Surat, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Indore, BhopalBhopal, Bangalore, Noida, Hyderabad, Lucknow, Jamshedpur, Pune, Delhi, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Hyderabad, PurniaPurnia, Guntur, Bangalore, Bhagalpur, Chennai, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Hyderabad, PurniaPurnia, Guntur, Bangalore, Bhagalpur, Chennai, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Guntur, ChennaiChennai, Hyderabad, Purnia, Bangalore, Bhagalpur, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Ahmedabad, MundraMundra, Mumbai City, Varanasi, Pune, Delhi 22 Jul, 2026

Urgent Requirements Post - Safety Supervisor Experience - 1yr to 5yr Salary - 20,000 to 40,000 location - Pune, Mumbai, Mundra, Ahmedabad, Delhi, Varanasi Site - Industrial,...
safety trainingsafety management systemsafety analysissafety engineeringsafety auditsafety inspection

Production Manager For Medical Devices & Equipment baesd at Lucknow
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Lucknow 22 Jul, 2026

Production Planning: Develop and execute production schedules to meet delivery timelines. Quality Control: Implement and monitor QC processes to ensure compliance with ISO, FDA, and CE standards...
medical equipmentmedical devices

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Lucknow, NoidaNoida, Delhi, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Varanasi, DelhiDelhi, Pune, Mumbai City, Mundra, Ahmedabad 22 Jul, 2026

Urgent Requirements Post - Safety Supervisor Experience - 1yr to 5yr Salary - 20,000 to 40,000 location - Pune, Mumbai, Mundra, Ahmedabad, Delhi, Varanasi Site - Industrial,...
safety trainingsafety management systemsafety analysissafety engineeringsafety auditsafety inspection

Customer Service Manager Chennai
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Chennai 22 Jul, 2026

Key Responsibilities:

Handle end-to-end customer complaints received through the RBI CMS portal.

Act as the liaison between the organization, customers, and the RBI Ombudsman...
customer servicehome loans

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Bangalore, PurniaPurnia, Guntur, Bhagalpur, Chennai, Hyderabad, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

Jewellery Consultant
WAAYS LIVE SOLUTIONS PRIVATE LIMITED 1.00 to 10.00 Years Ahmedabad 22 Jul, 2026

Jewellery Consultant

Position: Jewellery Consultant
Job Summary
A Jewellery Consultant is responsible for delivering an exceptional customer experience by assisting custo...
sales coordinationcommunication skills

AGM - Downstream Processing
Cadila Pharmaceuticals Ltd 1.00 to 10.00 Years Ahmedabad 22 Jul, 2026

Role Overview Department: DSP Designation: AGM Reporting To: General Manager Principal Tasks and Responsibilities Lead and supervise the downstream processi...
hplcanalytical developmentdownstream processing

Cyber Security Threat Detection and Response Operations Manager
Ernst & Young LLP ( EY India ) 1.00 to 10.00 Years Thiruvananthapuram 20 Jul, 2026

TC - CS - CDR - SOC - Manager At EY, were all in to shape your future with confidence. Well help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you w...
Security MonitoringCloud SecurityProject ManagementPerl scriptingSIEM technologiesCyber Incident ResponseIOTOTEndpoint ProtectionRegEx

AML Operations Analyst AML Quality Control (AML QC)
Gratitude Inc 1.00 to 10.00 Years Chennai 20 Jul, 2026

AML Operations Analyst AML Quality Control (AML QC) | Bangalore / Chennai | Up to 12.5 LPA Location: Bangalore or Chennai Experience: 10 Years Salary: Up to 12.5 LPA Band: BPO 3/4 Hiring: Immedi...
Transaction MonitoringRisk AssessmentRegulatory ComplianceDocumentationReport WritingAML OperationsFinancial Crime ComplianceAML Quality ControlFCRM systems

Cyber Security Operations Analyst
Cybage 1.00 to 10.00 Years Mumbai City 20 Jul, 2026

Department Engineering Location Pune Work Experience 6years About The Position The Senior Security Operations Analyst will be responsible for monitoring security alerts, in...
Security OperationsSOCInfrastructure SecurityEnterprise Security SupportCrowdStrike EDRCrowdStrike NextGen SIEMZscalerForescout NACDLP Solutions

MBA Hiring | Manager - Health Claims (Claims MIS & Operations Analyst) (Uttar
TATA AIG General Insurance Company 1.00 to 10.00 Years All India 20 Jul, 2026

Role & responsibilities: - Maintaining, tracking, and analyzing claim savings, high-value claims, pending queries, dependencies, and other operational data. - Analyze key claims performance metr...
Analytical skillsClaim processingData analysisOperations managementCommunication skillsExcelSQL

Retail Banking Fraud Operations Analyst Hyderabad
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Hyderabad 20 Jul, 2026

Retail Banking Fraud Operations Analyst Location: Hyderabad Experience: 1 to 5 Years CTC: Up to 5.5 LPA Qualification: Any Graduate Shift: US Shift Notice Period: Immediate Joiners or Candi...
Fraud DetectionFraud InvestigationChargebacksBanking OperationsRetail Banking Fraud OperationsFraud Analyst

Global Payments Credit Risk/Fraud Analyst 2 Years Bangalore
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Bangalore 20 Jul, 2026

Hiring | Global Payments Credit Risk/Fraud Analyst | 2 Years | Up to 5.5 LPA | Bangalore Location: Bangalore Experience: 2 Years CTC: Up to 5.5 LPA Qualification: Any Graduate Notice Period:...
transaction monitoringfraud operationspayment operationsfraud analystglobal paymentscredit risk analyst

Hiring For Customer Care Executive International Voice Process
Varda HR LLP 1.00 to 10.00 Years Thane, Mumbai City 20 Jul, 2026

Urgent Hiring | International BPO Position: Customer Support Executive International BPO Salary: Up to 40,000 (In-hand) Location: Thane / Malad Eligibility: HSC/Graduates can apply Freshers are...
international callingcustomer carecustomer retentioncustomer servicecustomer supportvoice processactive listeningcomplaint resolutionfirst call resolution

Fraud Analyst
HCL Technologies Ltd 1.00 to 10.00 Years Bangalore 20 Jul, 2026

Job Description Analyst Fraud Ops Designation Analyst/Sr Analyst Work Location Bengaluru (Cessna business park) Work From Office (5 days) Shifts Night Shifts (PST Time zone) ...
suspicious activity reportingfraud detectionimpersonationsfraud analysisfraud investigation

PREV
NEXT

complaint investigation Job Openings

Safety Supervisor Dabur India Limited (Job Description)

Urgent Hiring | Guest Relation Executive | Lucknow | 1-4 Years | Upto 20000 Salary

Job Summary We are looking for a dynamic, customer-focused, and professional Guest Relatio... communicationcustomer relationshipguest relationsguest servicecustomer servicehotel operationsreceptionguest handling

Contact Person :97,17,22,36,28 Renu Mam

Job Description

Jewellery Consultant

Position: Jewellery Consultant

Job Summary

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job Summary We are looking for a dynamic, customer-focused, and professional Guest Relatio...
communicationcustomer relationshipguest relationsguest servicecustomer servicehotel operationsreceptionguest handling