consumer experiences jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

consumer experiences Job Openings

Showing 3801 - 3850 of 8339 Jobs

call center assistant manager

GoldenJobs Placement Solutions Pvt Ltd 2.00 to 3.00 Years Navi Mumbai,Mumbai City, Thane 01 Apr, 2025

Job Title:

Location:

call center managementcentercustomer servicecallmanager

Sales Manager
Elevate Realty 2.00 to 6.00 Years Lucknow,Other Uttar Pradesh 01 Apr, 2025

Were Hiring: Sales Manager Real Estate Are you a dynamic and results-driven sales professional passionate about real estate Were seeking an experienced Sales Manager to lead our sales team, d...
SalesTeam LeadershipCommunicationNegotiationInterpersonal Skills

Business Development Director
M/S B NANDI 7.00 to 12.00 Years Kochi,Qatar, Bhubaneswar, Mauritius, Bangalore, Noida, Sri Lanka, Chennai, United Arab Emirates, Nor 01 Apr, 2025

JobsBusiness Development Director Job duties and Responsibilities.

Develops and strengthens internal and external relationships that will lead to increased lead generation and market s...
business developmentbusiness researchbusiness-to-businessbusiness analysisbusiness management skillsbusiness excellencedirectoriesbusiness planningdirectorship

Hiring for Field Sales Associate
AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Lucknow,Delhi, Jaipur, Gurugram, Ranchi 01 Apr, 2025

About the Company: Over the years, we have invested wisely in developing own proprietary tools and management methodologies which provide an edge to our client's relationship marketing progr...
sales marketingmarketing executive

Field Sales Officer - Plastic Industry
O3Hire Hiring For O3hire 0.00 to 4.00 Years Lucknow,Kanpur, Varanasi 01 Apr, 2025

Itactively selling plastic products manufactured by a company to various industries, requiring a strong understanding of plastic materials, applications, and market trends, w...
outside salesplasticfurniture salesfield worksalesb2cb2b sales

Apply Business Development Manager Insurance Salary upto-4Lac
Niyukti Management Consultants 4.00 to 9.00 Years Ludhiana,Chandigarh, Jalandhar, Amritsar, Patiala, Jaipur, Karnal, Jodhpur, Kurukshetra, Yamunanagar 01 Apr, 2025

life Insurance Post- Sales Manager, Location Chandigarh,Karnal,Kurukshetra,Yamunanagar,AmritsarJalandhar,Ludhiana,Patiala,Jaipur,Jodhpur Salary- 4 lac Rimb Incentive Exp.3 To 14 In sales Th...
territorydevelopmentsalesinsuranceareaagencyrelationshipbusinessmanager

Graphic Designer - Onsite
Education Culture Pvt Ltd 2.00 to 6.00 Years Ludhiana,Other Punjab 01 Apr, 2025

The ideal candidate will have strong creative skills and a portfolio of work which demonstrates their passion for illustrative design and typography. This candidate will have experiences in workin...
typographygraphic designAdobe Creative Suitecommunicationillustrative design

Opening in Agency And Direct Channel Jalandhar & ludhiana location.
ATS Infovision 2.00 to 6.00 Years Ludhiana,Chandigarh, Jalandhar, Amritsar, Una, Dharamshala, Solan, Shimla 01 Apr, 2025

Dear Candidates, Greetings of the day! You can contact us on Mobile No. :hidden_mobile or just a message on whatsapp with Yes to get a call back agency channelagency developmentbusiness developmentagencyassociate developmentlife insurance

RETAIL COUNTER MANAGER
Camerry Ice Cream 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Job description Camerry Ice Cream is seeking a dynamic and motivated Retail Counter Manager to oversee daily operations at our retail counter. If you are passionate about customer service, team l...
Customer ServiceTeam LeadershipInventory ManagementTrainingSales Performance Monitoring

Incident Management Lead
EY 5.00 to 9.00 Years Kochi,Other Kerala 01 Apr, 2025

At EY, youll have the chance to build a career as unique as you are, with the global scale, support, inclusive culture and technology to become the best version of you. And were counting on your u...
ITILIT Service ManagementData analyticsCommunicationSAP technologiesServiceNow ITSM suiteServiceNow reporting

iOS App Development Internship in Cochin (Hybrid)
HUMMRCHAT LTD 0.00 to 4.00 Years Kochi,Other Kerala 01 Apr, 2025

Selected Interns Day-to-day Responsibilities Include Contributing to the development of mobile applications from conception through deployment for the HUMMR CHAT app targeted for both Android and...
JavaRESTful APIsGoogle MapsFirebaseKotlinUser AuthenticationData StorageThirdparty API IntegrationMaterial Design

Business Development Director
M/S B NANDI 7.00 to 12.00 Years Kochi,Qatar, Bhubaneswar, Mauritius, Bangalore, Noida, Sri Lanka, Chennai, United Arab Emirates, Nor 01 Apr, 2025

JobsBusiness Development Director Job duties and Responsibilities.

Develops and strengthens internal and external relationships that will lead to increased lead generation and market s...
business developmentbusiness researchbusiness-to-businessbusiness analysisbusiness management skillsbusiness excellencedirectoriesbusiness planningdirectorship

Technical Solutions Architect
eBizneeds 5.00 to 9.00 Years Jaipur,Other Rajasthan 01 Apr, 2025

Company Description eBizneeds has been creating exceptional software and digital experiences since the dawn of the digital age. As pioneers in the tech industry, our highly talented team of devel...
Solution ArchitectureEnterprise ArchitectureConsultingPYTHONSoftware DevelopmentCommunicationInterpersonal SkillsMERN

TGT Social Science
TeachersHelpTeachers Pvt Ltd 6.00 to 10.00 Years Jaipur,Other Rajasthan 01 Apr, 2025

Exciting Career Opportunity at a Residential School near Jaipur! We are looking for passionate Primary School Mentors for Social Science, to join , a values-driven institution dedicated to foster...
Social ScienceEducational philosophySchool Administration

Hiring for Field Sales Associate
AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Jaipur,Delhi, Lucknow, Gurugram, Ranchi 01 Apr, 2025

About the Company: Over the years, we have invested wisely in developing own proprietary tools and management methodologies which provide an edge to our client's relationship marketing progr...
sales marketingmarketing executive

Head Chef
Sahastra Foods And Services PVT LTD 5.00 to 9.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Role Overview: The Head Chef at Adams Ale is responsible for leading the kitchen team, managing culinary operations, and ensuring the delivery of high-quality food. The role involves menu developm...
Menu DevelopmentStaff ManagementInventory ManagementCost ControlCustomer SatisfactionLeadership SkillsTime ManagementCommunication SkillsInterpersonal SkillsHealthSafety RegulationsCollaboration with ManagementOrganizational Skills

Online Sales Marketing Manager
DAYA WORLDWIDE LIMITED 3.00 to 7.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Company Description DAYA WORLDWIDE LIMITED is a prominent supplier of premium quality imported lighting and furniture, with multiple warehouses across India including Mumbai and Indore. Specializ...
Online Sales ManagementMarketing StrategyDigital MarketingSEOSEM

Robotics Trainer
Youngovator 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Company Description Youngovator is Indias leading phygital community platform designed for young innovators. We focus on enhancing cognitive and social skills of children through engaging technol...
RoboticsElectronicsMechanical EngineeringProgramming LanguagesPythonROSCurriculum DesignEducational TechnologyMentoringCoachingTrainingCommunicationTeamwork

Female Fresher School Teacher in DPS Public School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Hyderabad,Bangalore, Cuttack, Amritsar, Jalandhar, Pune, Delhi, Dalhousie, Vadodara, Guwahati 01 Apr, 2025

Key Responsibilities:

teacher trainingeducational consultingteachingschool teacherteacherclass teacher

Debt Manager
Live Connections 3.00 to 7.00 Years Hyderabad 01 Apr, 2025

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio...
collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Chat Support Executive
JDM CONSULTANCY 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Dear Candidate, We have Urgent Hiring for Chat Executive in IGT Solutions : Roles and Responsibilities : _Develop and implement e-commerce st...
chat processnon voicecustomer servicebpoemailemail processchatbackend operations

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

Guest Relations Executive
GREATBELL HR Consultancy Services (P) Ltd 1.00 to 5.00 Years Wayanad,Other Kerala 01 Apr, 2025

Skills: Customer Service, Hospitality Industry, Guest Relations, Front Office Operations, Front office, Aviation, Hospitality Management, Resort, Company Overview GREATBELL HR Consultancy Servic...
Customer ServiceHospitality IndustryGuest RelationsFront Office OperationsFront officeAviationHospitality Management

customer service Executive
IMPACT UNIVERSAL XPERTS 0.00 to 1.00 Years Delhi,Ghaziabad, Noida 01 Apr, 2025

Key Responsibilities: - Respond to customer inquiries via phone, email, and chat - Resolve customer issues in a timely and effective manner - Provide accurate and concise information to customer...
customer serviceinbound processcustomer supportoutbound process

Regional sales director- Reasl estate and project sales
MEGMA SERVICES 10.00 to 20.00 Years Delhi,Noida, Gurugram 01 Apr, 2025

Leading Engineering and construction company requires Regional sales Director( Real estate) - Dehi/ Gurugram/Noida We are looking out for Regional sales director ( Real estate and Project sales)...
project salesdirector salesregional sales manager

Female Fresher School Teacher in DPS Public School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Delhi,Bangalore, Cuttack, Hyderabad, Amritsar, Jalandhar, Pune, Dalhousie, Vadodara, Guwahati 01 Apr, 2025

Key Responsibilities:

teacher trainingeducational consultingteachingschool teacherteacherclass teacher

Sales Officer
DREAMS SOLUTIONS Fresher Chandigarh 01 Apr, 2025

SALES OFFICER FRESHER/EXPERIENCES 2.5CTC INCENTIVES LOCATION - CHANDIGARH,KHARAR,ZIRAKPUR IMMIDIATE JOINER REQUIRED INTERVIEW DATE- 20 MARCH A Sales Officer isresponsible for selli...
salesgraduates

Sales Manager South AND West
EMPLOYMENT AGENCY 5.00 to 10.00 Years Bhopal,Ahmedabad, Bangalore, Chennai, Hyderabad, Mumbai City 01 Apr, 2025

Job Title: Sales Manager (South or West India) Location: Work from Home Working Days: Monday to Saturday Working Hours: 9:3...
team leadingconsumer goodsfield sales

Business Development Director
M/S B NANDI 7.00 to 12.00 Years Pune,Qatar, Bhubaneswar, Mauritius, Bangalore, Kochi, Noida, Sri Lanka, Chennai, United Arab Emirate 28 Mar, 2025

JobsBusiness Development Director Job duties and Responsibilities.

Develops and strengthens internal and external relationships that will lead to increased lead generation and market s...
business developmentbusiness researchbusiness-to-businessbusiness analysisbusiness management skillsbusiness excellencedirectoriesbusiness planningdirectorship

Regional sales director- Reasl estate and project sales
MEGMA SERVICES 10.00 to 20.00 Years Noida,Delhi, Gurugram 28 Mar, 2025

Leading Engineering and construction company requires Regional sales Director( Real estate) - Dehi/ Gurugram/Noida We are looking out for Regional sales director ( Real estate and Project sales)...
project salesdirector salesregional sales manager

Assistant Manager - Operations
BN Recruitment Services Hiring For Banking 2.00 to 7.00 Years Hyderabad,Bangalore, Chennai, Other Tamil Nadu, Other Andhra Pradesh, Pondicherry, Vishakhapatnam, O 28 Mar, 2025

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales...
back office operationsteam handlingoperationscommunication skills

Hiring Guest Relationship ManagerSenior Manager with Top IT MNC in Hyderabad
People First Consultants Pvt Ltd 10.00 to 16.00 Years Hyderabad 28 Mar, 2025

Hi, We are hiring for Client Visit/Guest Relationship Management role for one of our premium client in Hyderabad. Role: Senior Manager - Client Visit Experience: 10 years Location: Hyderabad guest relationship managementguest handlingguest satisfactionguest serviceguest relations

AWS Data Engineer
LTIMindtree Limited 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Pune, Mumbai City 28 Mar, 2025

Primarily looking for a Data Engineer with expertise in processing data pipelines using Databricks PySpark SQL on Cloud distributions like AWS Must have AWS Databricks sqldatabrickspythonaws

Sales Development Manager-Banca channel- HDFCLIFE
HFDC Life Insurance Company Limited 1.00 to 2.00 Years Hyderabad 28 Mar, 2025

Job description Role & responsibilities

Developing and implementing sales strategies to meet sales targets for life insurance products.

Ach...
salesrelationship managementbusiness developmentfield sales

Hiring for Curriculum Manager for Pre School At Gurugram
HR Globe Recruitment Service 5.00 to 10.00 Years Gurugram,Hyderabad 28 Mar, 2025

Dear Candidates, Hiring for Curriculum Manager for Pre School At Gurugram Call Hr on hidden_mobile Designation Curriculum / Centre Co-ordinator

Reporting ...
classroom managementcurriculum mappingteacher evaluation

Graphic Designer cum Video Editor
MNR Solutions Pvt Ltd 2.00 to 7.00 Years Noida 28 Mar, 2025

Job Responsibilities:

Create graphics and layouts for product illustrations, digital banners, e-mails templates, collaterals, newsletters, social media creatives, web ...
motion graphicsgraphic designingadobe photoshopvideo editing

Sales Head- Luxury Real estate
MEGMA SERVICES 10.00 to 18.00 Years Delhi,Gurugram, Mumbai City 28 Mar, 2025

Leading Luxury Interior construction brand Requires Sales Head - Mumbai or Delhi One of our client a leading luxury brand of Interior Products whi...
hni salesgm salessales managervp salesdirector salessales head

Wipro - Salesforce LWC Developer
Wroots Global Private Limited 7.00 to 12.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune 28 Mar, 2025

Job Title: Salesforce LWC Developer Location: PAN India Experience: 7 Years Job Description: We are seeking a skilled integrationsalesforce

Customer Community Marketing
ODH DEVELOPERS PRIVATE LIMITED 12.00 to 22.00 Years Chennai,Singapore, Oman, Zimbabwe, Saudi Arabia, Bangalore, Kuwait, Tanzania, Sudan, Auraiya, Hydera 28 Mar, 2025

We are looking for a Director of Customer & Community Marketing to spearhead our community-building and customer engagement efforts. In this role, you will be responsible for creating and nurtur...
communicationpresentationadaptabilitymanagementtimeskillsrelationships

Assistant Manager - Operations
BN Recruitment Services Hiring For Banking 2.00 to 7.00 Years Chennai,Pondicherry, Other Tamil Nadu, Bangalore, Hyderabad, Other Andhra Pradesh, Vishakhapatnam, O 28 Mar, 2025

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales...
back office operationsteam handlingoperationscommunication skills

AWS Data Engineer
LTIMindtree Limited 4.00 to 9.00 Years Chennai,Bangalore, Hyderabad, Pune, Mumbai City 28 Mar, 2025

Primarily looking for a Data Engineer with expertise in processing data pipelines using Databricks PySpark SQL on Cloud distributions like AWS Must have AWS Databricks sqldatabrickspythonaws

Hiring for Banking-Sales
Wroots Global Private Limited 1.00 to 4.00 Years Bangalore 28 Mar, 2025

WE ARE HIRING FOR TELE SALES PROCESS - ( TELE SALES) UG - GRADUATES GRADURTES - FRESHERS FRESHERS - EXPERIENCED LANGUAGE - HINDI /ENGLISH SALA...
banking salescold callingoutbound salestelesalessales

Hiring for Laravel PHP Developer
LAZZARO HR SOLUTIONS PRIVATE LIMITED 2.00 to 5.00 Years Mumbai City 27 Mar, 2025

Hi candidates, Greetings form Lazzaro.! Qualification: B.Tech/MCA Location: Malad East,Mumbai REQUIREMENTS: Proficient in PHP and the Laravel framework. Minimum of [2-5] years of experience...
technologylaravelphpdeveloperplusvue.js/reactgit/github/gitlab

Business Development Director
M/S B NANDI 7.00 to 12.00 Years Pune,Qatar, Bhubaneswar, Mauritius, Bangalore, Kochi, Noida, Sri Lanka, Chennai, United Arab Emirate 24 Mar, 2025

JobsBusiness Development Director Job duties and Responsibilities.

Develops and strengthens internal and external relationships that will lead to increased lead generation and market s...
business developmentbusiness researchbusiness-to-businessbusiness analysisbusiness management skillsbusiness excellencedirectoriesbusiness planningdirectorship

Frontend QA IRC249674
GlobalLogic 6.00 to 10.00 Years Nagpur,Other Maharashtra 24 Mar, 2025

Description GlobalLogic Requirements 6 Experience Experience in automation test but with experience in javascript preferably test using javascript framework (webdriver.io is what we use) Fami...
javascriptJavainternationalizationLocalizationanalytical skillsproblem solvingautomation testhtmlcssReactjest

T-Mobile Elastic Path IRC251656
Hitachi Careers 3.00 to 7.00 Years Nagpur,Other Maharashtra 24 Mar, 2025

Description -Development using the cloud-based platform to create unique customer experiences across various channels. It includes Composable Commerce, Microservices-based Supports, RESTful APIs,...
RESTful APIsComposable CommerceMicroservicesbased Supports

Tech PO IRC253744
Hitachi Careers 3.00 to 7.00 Years Nagpur,Other Maharashtra 24 Mar, 2025

Description Tech PO Good to have :Automotive domain Technical Product Owner is responsible for technical backlog management, prioritization, and its evaluation. Closely work with Scrum team(s) ...
RESTjavascriptRESTful APIsAutomotive domainreactnodejs

Data Scientist IRC260003
Hitachi Careers 2.00 to 6.00 Years Nagpur,Other Maharashtra 24 Mar, 2025

Description Tasked with partnering with numerous technical teams to collaborate, test hypotheses, build proof of concepts, and turn data into insights and information for accelerating Digital Fir...
Data modelingForecastingOptimizationData scienceEngineeringSnowflakeJavaPythonSoftware EngineeringExploratory data analysisFeature SelectionData PreparationNormalizationModel ValidationSQLNoSQLVisualizationTableauPower BIGoogle Analyt

PREV
NEXT

consumer experiences Job Openings

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio... collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales... back office operationsteam handlingoperationscommunication skills

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales... back office operationsteam handlingoperationscommunication skills

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio...
collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales...
back office operationsteam handlingoperationscommunication skills

Job brief We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales...
back office operationsteam handlingoperationscommunication skills