excel jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

excel Job Openings

Showing 3651 - 3700 of 16361 Jobs

DATA ENTRY OPERATOR HOME - BASED TYPING

VISHWANATH ENTERPRISES Fresher Hyderabad, BangaloreBangalore, Chennai, Kochi, Vijayawada, Kolkata, Pune, Chandigarh, Mysore, Ahmeda 25 Sep, 2025

writing skills

typing speed

handwriting work from home

freelancing

Tender / GeM Executive IT Hardware & AMC- Delhi

PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Delhi 25 Sep, 2025

Job Title: Tender / GeM Executive IT Hardware & AMC

Location:

Experience Required:

Workforce Planning Level 2 Fulfillment Solution Partner

NTT DATA North America Fresher Noida, Uttar Pradesh 25 Sep, 2025

Data Entry Operator (Work From Home)

MATTRIXX INDIA Fresher Chandigarh, GandhinagarGandhinagar, Chattisgarh, Ghaziabad, Dhanbad, Vijayawada, Karnataka, Panipat, 25 Sep, 2025

We offer various types of data entries work:

data entry work from home

work from home typing

data entry typing

QC Staff

Zydus Group Fresher Ahmedabad, Gujarat 25 Sep, 2025

HPLC

Dissolution apparatus

stability studies

UV Visible Spectrometer

Sales Distributor

Saathi Fresher Ahmedabad, Gujarat 25 Sep, 2025

knowledge of consumer product channels

Walking for freshers & Exp Finance, Executive,Tax,Analyst Leading Clients

Wisdom Bridge Management Consultants Fresher Vijayawada, RajahmundryRajahmundry, Srikakulam, Vizianagaram, Ongole, Kadapa, Tirupati, Vishakhapatn 24 Sep, 2025

Walking for freshers & Exp Finance, Executive,Tax,Analyst Leading Clients

Wisdom Bridge Management Consultants Fresher Vijayawada, RajahmundryRajahmundry, Srikakulam, Vizianagaram, Ongole, Kadapa, Tirupati, Vishakhapatn 24 Sep, 2025

Data Entry Operator (Work From Home)

MATTRIXX INDIA Fresher Vijayawada, GandhinagarGandhinagar, Chattisgarh, Ghaziabad, Dhanbad, Chandigarh, Karnataka, Panipat, 24 Sep, 2025

We offer various types of data entries work:

data entry work from home

work from home typing

data entry typing

we are hiring for manager role WFH

GLORIOUS HR SERVICES PRIVATE LIMITED Fresher Vishakhapatnam, HyderabadHyderabad, Bangalore, Chennai, Ghaziabad, Navi Mumbai, Thane, Pune, Mumbai 24 Sep, 2025

Manufacturing Materials Procurement & Inventory Management Entry Professional

Hitachi Careers Fresher Vadodara, Gujarat 24 Sep, 2025

Procurement

Supply Chain Management

Sr. Manager - FRD Non-Orals

SUN PHARMA Fresher Vadodara, Gujarat 24 Sep, 2025

process optimization

characterization

regulatory requirements

Head of Finance and Accounting

Cremach Private Limited Fresher Vadodara, Gujarat 24 Sep, 2025

Advance MS Excel

Tally

Service Tax

Finance relatoriescompliances Eg GST

IT Health Care Recruiter

The Career Company | India Fresher Vadodara, Gujarat 24 Sep, 2025

Interviewing

Client Relationship Management

Communication Skills

Interpersonal Skills

Analytical Skills

IT Healthcare Recruiter

Recruitment Strategies

Candidate Sourcing

Postings Management

Recruitment Metrics Analysis

Industry Trends Knowledge

Information Security Analyst - Vulnerability Management

Secure Meters Limited Fresher Udaipur, Rajasthan 24 Sep, 2025

Certified Ethical Hacker CEH

React. JS Developer

Axone Infotech India Fresher Surat, Gujarat 24 Sep, 2025

HR Recruitment Manager - Manufacturing

YO IT CONSULTING Fresher Surat, Gujarat 24 Sep, 2025

human resource development

process improvement

onboarding

stakeholder management

PHP Laravel Developer

Webiots Technologies Fresher Surat, Gujarat 24 Sep, 2025

Human Resources Executive

AllcargoGATI Fresher Surat, Gujarat 24 Sep, 2025

Advanced Excel for data analysis

reporting

Time Office operations

labor law compliance

Urgent requirement for Production Supervisor

sk online services Fresher Bhubaneswar, NashikNashik, Maharashtra, Odisha, Hyderabad, Nanded, Navi Mumbai, Thane, Ahmednagar, P 24 Sep, 2025

Company

Department

Location

Job Responsibil...
production managementproduction controlproductionproduction operationstestingmaterial handlingproduction planningteam leading

Dispatch Supervisor FMCG Company
sk online services Fresher Bhubaneswar, CuttackCuttack, Jharsuguda, Paradeep, Puri, Rourkela, Sambalpur, Balangir, Koraput, Odi 24 Sep, 2025

Job description In case of any query, kindly connect on78,34,98,21,39 Preference will be given to immediate joiners. INTERESTED CANDIDATES CAN CALL team handlingquality controlmanagement skillssite executionleadershipdispatch planning

Stock Audit Manager Retail Stores
Zion Corp Fresher Rajkot, Gujarat 24 Sep, 2025

The Stock Audit Manager is responsible for overseeing and conducting stock audits across multiple retail store locations to ensure inventory accuracy, identify discrepancies, and prevent stock los...
Analytical skillsInventory managementMicrosoft ExcelCommunication skillsProblemsolving skillsAttention to detailReporting skillsRetail stock management

Sr. Office / Executive for Accounts
A1 Human Wealth Management Private Limited Fresher Cuttack 24 Sep, 2025

As a Senior Officer/Executive for Account in the Manufacturing industry based in Orissa (Cuttack), you will be reporting to the Manager of Accounts & Finance. To qualify for this position, you sho...
SAP FICODebit NoteCredit NoteFixed Asset RegisterMicrosoft OfficeGSTR1GSTR3BGSTR2A Reconciliation

Urgent requirement for Production Supervisor
sk online services Fresher Bhubaneswar, NashikNashik, Maharashtra, Odisha, Hyderabad, Nanded, Navi Mumbai, Thane, Ahmednagar, P 24 Sep, 2025

Company: Dabur India Limited Department: Production / Maintenance / Safety (based on posting) Location: In Your State Job Responsibil...
production managementproduction controlproductionproduction operationstestingmaterial handlingproduction planningteam leading

Dispatch Supervisor FMCG Company
sk online services Fresher Bhubaneswar, CuttackCuttack, Jharsuguda, Paradeep, Puri, Rourkela, Sambalpur, Balangir, Koraput, Odi 24 Sep, 2025

Job description In case of any query, kindly connect on78,34,98,21,39 Preference will be given to immediate joiners. INTERESTED CANDIDATES CAN CALL team handlingquality controlmanagement skillssite executionleadershipdispatch planning

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Administrative Executive
SHRI BALAJI ENTERPRISES Fresher Bhubaneswar, BaddiBaddi, Indore, Kolkata, Jamshedpur, Pune, Mumbai City, Vadodara, Ahmedabad, Guwaha 24 Sep, 2025

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Site Civil Engineer
Floatex Solar Fresher Ranchi, Jharkhand 24 Sep, 2025

As a Site Engineer (Civil) at Floatex Solar Pvt Ltd in Tilaiya, Jharkhand, you will play a crucial role in the successful execution of projects under the guidance of the Site Incharge/Operation He...
Civil EngineeringSite EngineeringConstruction SupervisionProject ManagementBudgetingQuality ControlVendor Coordination

Area Sales Manager (ASM)
ANYTHING SKOOL LIMITED Fresher Ranchi, Jharkhand 24 Sep, 2025

You will be joining as an Area Sales Manager with 4-7 years of experience in the Education Industry, focusing on School Marketing. Your educational qualifications should include an MBA in Marketin...
MarketingSchool MarketingCommunication SkillsPresentation SkillsAnalytical SkillsTeam HandlingMarket Study

Assistant Sales Manager
Talent Leads HR Solutions Pvt Ltd Fresher Patna, RanchiRanchi, Bhubaneswar, Lucknow, Chandigarh, Bhopal 24 Sep, 2025

Job Description Description: Asst. Sales Manager Corporate and Private Sales Department: Sales && Business Development Experience Required: 5-6 years (Relevant Ex...
b2b saleschannel sales

Dot Net Developer
Ariel Software Solutions Fresher Punjab 24 Sep, 2025

You have an exciting opportunity to join our team as a Software Developer in Mohali, Punjab. With 1 to 4 years of experience, you will be responsible for creating top-quality applications and mana...
NETHTMLCSSJavaScriptAJAXjQueryBootstrapAngularJSSQL ServerMYSQLMongoDBPostgreSQLAutofacUnityNinjectNUnitXUnitMSTestNET languages CNET framework MVCNETWeb APIReactJSNET 45Net CoreEntity Framework 6EF CoreNHibernateADONETDepende

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Event Coordinator
JBS Event Management Group Fresher Punjab 24 Sep, 2025

As an event coordinator at JBS Event Management Group, you will be responsible for coordinating and executing event setups by closely working with vendors, production team, printing team, etc. You...
MS Office toolsRelationship managementEvent operationsGood communication skillsIndustry know howExtrovert natureConvincing attitudeTech savvyCoordinating

Make Up cum Salon Manager (Female)
Hair Raiserz Luxe Fresher Punjab 24 Sep, 2025

You are seeking a Professional Make Up Artist cum Salon Manager (Female Only) to oversee the day-to-day operations of the salon. Your responsibilities will include supervising staff, managing sche...
Developing Marketing StrategiesFinancial TransactionsMicrosoft OfficeMake Up ArtistSalon ManagerSupervising StaffManaging SchedulesMarketing ServicesMaintaining Financial RecordsManaging InventoryAddressing Customer ConcernsIndustry Trends

Purchase & Store Executive
SEQRONICS (INDIA) PRIVATE LIMITED Fresher Mysore 24 Sep, 2025

Position:Purchase Executive / Procurement Officer Experience:Minimum1 years Education:Diploma/BE in Electricals & Electronics...
dispatch planningpurchase management

Angular - Web Developer
Roots Infocomm Private Limited Fresher Ludhiana, Punjab 24 Sep, 2025

As a skilled Web Developer, you will be responsible for developing and/or designing web applications while collaborating with a team of developers. Your role will involve creating, maintaining, an...
AngularJavaScriptHTMLCSS

Executive - HR (Generalist)
Life Solutions Company Fresher Ludhiana, Punjab 24 Sep, 2025

As an HR Generalist at our company based in Ludhiana, you will play a vital role in managing various HR functions within the automobile industry. Your primary responsibilities will include: - Mana...
RecruitmentOnboardingHR policiesEmployee engagementGrievance handlingPerformance managementMIS reportsLabor lawsCommunication skillsInterpersonal skillsMS OfficeEmployee life cycleTrainingdevelopmentHR records managementCompliancesHR best p

Business Development Exec FS Amritsar
McCain Foods Limited Fresher Ludhiana, Punjab 24 Sep, 2025

The Business Development Executive at Amritsar is a key role focused on achieving targets through exceptional execution and service at Food Service outlets. Your responsibilities will include mana...
Client HandlingCommercial ManagementTeam LeadershipSalesBusiness DevelopmentActivation Execution

Computer Operator / Data Entry Clerk
Divine HR Services Fresher Kollam, BangaloreBangalore, Howrah, Chennai, Hyderabad, Tiruchirappalli, Pondicherry, Thane, Pune, T 24 Sep, 2025

Position:Entry-Level / Back Office Assistant / Computer Operator / Data Entry Clerk. Job Type: Part-time / Home-Based / Flexible Experience: 0-1 Year Salary Range: 3.0 - 7 LPA Work Location: ...
typingback office operationsback officepart timedata entryenglish writing

New Part Time work for Data Entry & Page typing work
V-Tech Data Outsourcing Fresher Kakinada, GunturGuntur, Hyderabad, Guntakal, Anantpur, Tambaram, Bangalore, Chennai, Kolkata, Kumbak 24 Sep, 2025

Responsibilities: Accurate and timely data entry of information into various systems. Handling data entry projects including E-Book Typing, Excel Numerical Entry, and Manual Fo...
data entrytypingmanualdata entry work from hometyping speedcopyingdata entry typing

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Customer Associate
Jobs Territory Fresher Kochi, ThrissurThrissur, Idukki, Palakkad, Thiruvanananthapuram, Kannur, Wayanad, Thiruvananthapuram 24 Sep, 2025

Job Description - Associate/Senior Associate Customer Service Designation: Associate/Senior Associate Customer Service Experience: 0 - 5 years Location: Trivandrum(Thrivanthupuram) Skill Req...
communication skillsgoing the extra mileflexible approachputting the customer firstconvincing power

New Part Time work for Data Entry & Page typing work
V-Tech Data Outsourcing Fresher Kakinada, GunturGuntur, Hyderabad, Guntakal, Anantpur, Tambaram, Bangalore, Chennai, Kolkata, Kumbak 24 Sep, 2025

Responsibilities: Accurate and timely data entry of information into various systems. Handling data entry projects including E-Book Typing, Excel Numerical Entry, and Manual Fo...
data entrytypingmanualdata entry work from hometyping speedcopyingdata entry typing

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Customer Associate
Jobs Territory Fresher Kochi, ThrissurThrissur, Idukki, Palakkad, Thiruvanananthapuram, Kannur, Wayanad, Thiruvananthapuram 24 Sep, 2025

Job Description - Associate/Senior Associate Customer Service Designation: Associate/Senior Associate Customer Service Experience: 0 - 5 years Location: Trivandrum(Thrivanthupuram) Skill Req...
communication skillsgoing the extra mileflexible approachputting the customer firstconvincing power

Customer Service Quality Analyst
Chris Johnson Business IT Solutions Fresher Kochi, Kerala 24 Sep, 2025

As a Quality Analyst, your role will involve calibrating and supporting quality standards to ensure that quality and customer satisfaction goals are met in a timely manner. You will be responsible...
CRMCustomer ServiceInterpersonal SkillsVerbal CommunicationWritten CommunicationResearchAnalytical SkillsExcelTelecom experienceQuality AnalystProblemsolving Skills

Junior Angular Developer
HighQ-Labs Pvt Ltd Fresher Kochi, Kerala 24 Sep, 2025

You will be responsible for developing and maintaining code in accordance with predefined cost, company, and security standards. Your role will involve working on bug fixes, supporting the mainten...
rest apiSQLMongoDBsoftware programmingHTMLCSSAngular 2Hibernate Java

Field Sales Executive - BFSI
Sarika HR Solutions Fresher Kochi, Chennai 24 Sep, 2025

Job Purpose To offer customized insurance solution to the customers for all their financial needs and act as an interface between customer and company Responsibilities To direct sell to the cu...
banking salessellingfieldfield salessalesinsurance brokeragebankinginsurance salesinsurancefield collectionslife insurancestreet

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Officer-Business Development
Cultivator Phyto Lab Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Officer-Business Development at Cultivator Phyto Lab, you will have the opportunity to identify and pursue new business opportunities, build and maintain relationships with clients and partn...
SalesMarketingBusiness DevelopmentRelationship Building

PREV
NEXT

excel Job Openings

Job description In case of any query, kindly connect on78,34,98,21,39 Preference will be given to immediate joiners. INTERESTED CANDIDATES CAN CALL team handlingquality controlmanagement skillssite executionleadershipdispatch planning

Job description In case of any query, kindly connect on78,34,98,21,39 Preference will be given to immediate joiners. INTERESTED CANDIDATES CAN CALL team handlingquality controlmanagement skillssite executionleadershipdispatch planning

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ... communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill