house to house campaign jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

house to house campaign Job Openings

Showing 1951 - 2000 of 5201 Jobs

Head Chef

Sahastra Foods And Services PVT LTD 5.00 to 9.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Customer Satisfaction

Collaboration with Management

Organizational Skills

Reviewer

Granthaalayah Publications and Printers 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Business Lead- Digital Marketing

HR THINKER LAB LLP 5.00 to 8.00 Years Indore 01 Apr, 2025

Key Responsibilities:

Business Development & Client Acquisition:

Drive business growth through new client acquisitions for services ...
salessocial marketingseo

Area Sales Manager

Transformatrix Global Private Limited 6.00 to 11.00 Years Hyderabad 01 Apr, 2025

Hr Manager

JOB HUB HOUSE 2.00 to 7.00 Years Hyderabad 01 Apr, 2025

hr operations

hr analytics

Male Front Office - MEHEDIPATNAM, KPHB

AURA HEARING CARE PRIVATE LIMITED 1.00 to 4.00 Years Hyderabad 01 Apr, 2025

- To welcome & Assist Customer on their arrival in clinics.
- Take down customers details and information. (Forms and official Templates to be filled).
- Confir...
  cash receiptsms officeinvoice processingbillingpetty cash

Debt Manager

Live Connections 3.00 to 7.00 Years Hyderabad 01 Apr, 2025

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio...
collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Deputy General Manager Finance & Accounts
Employee deal consultants Hiring For A reputed Ready-made Garment Export House 18.00 to 25.00 Years Gurugram,Delhi 01 Apr, 2025

A reuputed Readymade garment manufacturing company is hiring Deputy General Manager Accounts. Looking for a candidate with preferably 20 years of experience. Out of which 10 years minimum should ...
balance sheet finalisationaccounts finalisationtaxationbank limit

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Manager Hrd
Employee deal consultants Hiring For A Reputed Readymade Garment Export House 15.00 to 25.00 Years Gurugram 01 Apr, 2025

A reputed garment export House is looking for a HR Head. The company has 3 units in Gurugram . HR Officers in all units will be gradualy reporting to him. The opening is based in Head Office and ...
hr compliancelabour lawshr generalist activitieslabour welfare

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Field Marketing Manager
LEADERS GROUP 2.00 to 6.00 Years Kannur,Other Kerala 01 Apr, 2025

Were Hiring: Field Marketing Manager Are you a results-driven marketer who loves on-ground activations and outreach Join our team as a Field Marketing Manager and lead impactful marketing campai...
Offline MarketingEvent ManagementBrand AwarenessLead GenerationTeam ManagementCampaign AnalysisCommunication SkillsRelationship BuildingSponsorship ManagementPartnership BuildingBTL ActivitiesDatadriven

Creative Strategist
Samagra Progressive Learning Solutions Pvt Ltd 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Samagra Progressive Learning Solutions Private Ltd is the brainchild of Madhu Bhaskaran, a renowned Business Strategist and HRD trainer. We aim to create a sense of total revamping in the lives of...
Market ResearchContent CreationCommunity EngagementCampaign ManagementBrand AwarenessLead GenerationVideo ProductionSocial Media StrategySocial Media Analytics

Quality Assurance Analyst
Emerson 1.00 to 5.00 Years Chandigarh 01 Apr, 2025

Job Description Job Summary The Quality Assurance Analyst will test web-based applications and API used by our employees and customers. They will provide support to end-users in the organization...
Quality AssuranceTestingAPISoftware ApplicationsTest CasesSystem IntegrationRegression TestingPerformance TestingCustomer ServiceBug TrackingMicrosoft TechnologiesCommunication SkillsOrganization SkillsInterpersonal SkillsAgile ScrumSQLAut

Digital Marketing Intern
Momade Miracles 0.00 to 4.00 Years Panchkula,Other Haryana 01 Apr, 2025

Market research: Collecting data to identify target audiences, new markets, and campaign success Content creation: Writing marketing materials like blog posts, social media posts, press releases,...
Market researchContent creationCampaign executionSocial media

Sales and Marketing Coordinator
Goat Robotics 2.00 to 6.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Job Title: Sales and Marketing Coordinator Job Summary: Key Responsibilities: Handle Request for Quotations (RFQs) from clients, ensuring accurate and timely submissions. Track and manage the ...
order processingMS Officecommunicationinterpersonal skillsB2B salesindustrial salesERPdigital marketinglead generationRFQ handlingsales pipeline managementCRM toolsorganizational skillsmultitasking

Sales Officer, Real Estate, sal up To 60k
Creative Hands HR Consultancy 1.00 to 6.00 Years Coimbatore,Chennai, Hyderabad 01 Apr, 2025

JOB DESCRIPTION: Front Line Sales - Chennai salary- 18hidden_mobile0k Minimum 1-8 years of experience salesreal estate sales

Equity Dealers
QRN Services 1.00 to 5.00 Years Chennai,Bangalore, Mangalore, Hubli 01 Apr, 2025

locations: Bangalore, Mangalore, Hubli, Hosur, Chennai, Company: A reputed broking firm Position:Equity Dealer Prime Responsibility Revenue generation from dealing & Other Product & Services ...
revenue generationshare marketclient acquisitionnismequitysecurities tradingmututal fundfinancial market

Data Entry Executive Work, Open to All Applicants
Pick Bright HR Solution 0.00 to 1.00 Years Pune,Bangalore, Guntur, Other Tamil Nadu, Nellore, Kanyakumari, Kozhikode, Thrissur, Mangalore, Alla 28 Mar, 2025

Dear employee , Part time works Computer works Home based works For- Students, house wifes, Retired person & Job Employees.The golden opportunity you are seeking is in yourself. Position: Fresh...
backendtypingdata entry

Logistics Executive
Montek Tech Services Pvt Ltd 2.00 to 7.00 Years Pune,Ahmednagar 28 Mar, 2025

Hello, We have opening for Logistics Technical Executive for FMCG Brand Rajangaon Location. Job Purpose Thispositiondemandseffective planning and executiontoensure meeting market demand by ship...
logistics managementpower bitechnical

Digital marketing - Work frm home
MPD Ventures LLP 1.00 to 2.00 Years Noida,Bangalore, Chennai, Kolkata, Mumbai City 28 Mar, 2025

Job Title: Digital Marketing Executive (Work from Home) MPD Ventures LLP Job Type: Part-time (4 hours per day) Location: Remote (Work from Home) Salary: 7,500 - 15,000 per m...
cssemail marketingphotoshophtmlcreative strategyweb designcontent creationfacebook ads

Edtech Sales
EXCELR EDTECH PRIVATE LIMITED 1.00 to 5.00 Years Mumbai City,Pune, Thane, Bangalore 28 Mar, 2025

Job Title-Inside Sales Manager An Inside Sales Manager (individual contributor) will generate income by assisting participants & coordinating with the training staff using both phone sal...
b2cbdebusiness developmentlead generationeducational salescold callingsales

opening for Manager-Sales and Marketing (India)
LOTUS TECHNICALS PRIVATE LIMITED 6.00 to 11.00 Years Navi Mumbai,Mumbai City, Thane 28 Mar, 2025

Dear Candidate, Job opening for Manager-Sales and Marketing (India) Exp-6 yrs Sales

To understand the sales territories and scope of work in detail

To agree on the sales t...
equipmentpharmasalesclean rooms

Digital marketing - Work frm home
MPD Ventures LLP 1.00 to 2.00 Years Mumbai City,Bangalore, Chennai, Noida, Kolkata 28 Mar, 2025

Job Title: Digital Marketing Executive (Work from Home) MPD Ventures LLP Job Type: Part-time (4 hours per day) Location: Remote (Work from Home) Salary: 7,500 - 15,000 per m...
cssemail marketingphotoshophtmlcreative strategyweb designcontent creationfacebook ads

Accounts & Admin Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 16.00 Years Mumbai City,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Mangalore, Delhi, Other Karnata 28 Mar, 2025

Our personal finance consultancy firm needs an Administrative Manager to take over administrative operations at our downtown location. We are looking for a highly organized and efficient profess...
auditingmanagementtimebudgetingreceivableanalysisaccountsreporting

Digital Marketing Executive
H I R E 2.00 to 7.00 Years Hyderabad 28 Mar, 2025

Greeting from H I R E! Hiring for the following Job Vacancy :Digital Marketing Executive Key Responsibilities 1. Develop and implement comprehensive digital marketing strategies to promote our...
campaign managementdigital marketingwebsite analysiscampaign development

Collection Manager
Live Connections 4.00 to 8.00 Years Hyderabad,Bangalore 28 Mar, 2025

Roles & Responsibilities:

Responsible to handle an area for collections of specific products

Responsible for collection efficiency and cost of collections fo...
recovery managementrecovery collectionscollection managementcollection framework

Hiring Guest Relationship ManagerSenior Manager with Top IT MNC in Hyderabad
People First Consultants Pvt Ltd 10.00 to 16.00 Years Hyderabad 28 Mar, 2025

Hi, We are hiring for Client Visit/Guest Relationship Management role for one of our premium client in Hyderabad. Role: Senior Manager - Client Visit Experience: 10 years Location: Hyderabad guest relationship managementguest handlingguest satisfactionguest serviceguest relations

Full Stack Dot Net Developer
Best Infosystems Ltd 7.00 to 10.00 Years Hyderabad 28 Mar, 2025

Full Stack Dot Net Developer_Contract-to-hire position with a duration of six months_Hyderabad_Hybrid_(with top Fortune 40 captive FMCG) Job Title: Full Stack Dot Net Developer Duration: Contrac...
full stack

Customer Service Executive
Square Business Services Pvt Ltd 0.00 to 4.00 Years Hyderabad 28 Mar, 2025

Excellent Opportunity to work for Indias LargetHealthcare TPA ***Spot Offer & Immediate Joining with one of the Indias fastest growing BPO*** ***Only ...
voice supportbpo operationsenglishcustomer service operationscustomer servicedomestic bpo

Performance Marketing Manager
GoMechanic 1.00 to 5.00 Years Gurugram 28 Mar, 2025

We are looking for a Performance Marketing Specialist with 2 years of experience in managing digital marketing campaigns across Google Ads, Meta (Faceboo...
digital marketinggoogle adwordsuac

Deputy General Manager Finance & Accounts
Employee deal consultants Hiring For A reputed Ready-made Garment Export House 18.00 to 25.00 Years Delhi,Gurugram 28 Mar, 2025

A reuputed Readymade garment manufacturing company is hiring Deputy General Manager Accounts. Looking for a candidate with preferably 20 years of experience. Out of which 10 years minimum should ...
balance sheet finalisationaccounts finalisationtaxationbank limit

Sales Head- Luxury Real estate
MEGMA SERVICES 10.00 to 18.00 Years Delhi,Gurugram, Mumbai City 28 Mar, 2025

Leading Luxury Interior construction brand Requires Sales Head - Mumbai or Delhi One of our client a leading luxury brand of Interior Products whi...
hni salesgm salessales managervp salesdirector salessales head

Brand Marketing Coordinator
Frontier Raas Pvt Ltd 2.00 to 5.00 Years Noida 28 Mar, 2025

We need a Male candidate forBrandMarketingCoordinator positionon Immediate Basis ! Job Location: Noida Sector 6 Experience: Minimum 3 to 5 years in Fashion Retail Industry Wor...
content marketingbrand awarenessmood boardsshopifyexcelbrand marketingshoots

Digital marketing - Work frm home
MPD Ventures LLP 1.00 to 2.00 Years Chennai,Bangalore, Noida, Kolkata, Mumbai City 28 Mar, 2025

Job Title: Digital Marketing Executive (Work from Home) MPD Ventures LLP Job Type: Part-time (4 hours per day) Location: Remote (Work from Home) Salary: 7,500 - 15,000 per m...
cssemail marketingphotoshophtmlcreative strategyweb designcontent creationfacebook ads

Digital marketing - Work frm home
MPD Ventures LLP 1.00 to 2.00 Years Bangalore,Chennai, Noida, Kolkata, Mumbai City 28 Mar, 2025

Job Title: Digital Marketing Executive (Work from Home) MPD Ventures LLP Job Type: Part-time (4 hours per day) Location: Remote (Work from Home) Salary: 7,500 - 15,000 per m...
cssemail marketingphotoshophtmlcreative strategyweb designcontent creationfacebook ads

Editor - Science
Flexi Careers India Pvt Ltd 3.00 to 8.00 Years Bangalore 28 Mar, 2025

Edit and rewrite Science content for factual accuracy, English language and usage Develop manuscripts to match level-appropriate learning goals for subject-specific school textbooks. Develop cr...
scienceeditingproof reading

Accounts & Admin Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 16.00 Years Mumbai City,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Mangalore, Delhi, Other Karnata 27 Mar, 2025

Our personal finance consultancy firm needs an Administrative Manager to take over administrative operations at our downtown location. We are looking for a highly organized and efficient profess...
auditingmanagementtimebudgetingreceivableanalysisaccountsreporting

Digital Marketing Advisor - Mumbai
Quess Corp (Magna Infotech) 2.00 to 6.00 Years Mumbai City 27 Mar, 2025

In-depth Knowledge of Digital media planning Eco system with expertise in ad-Operations, Programmatic space, PMP, PMPG, RTB etc. Understanding, Implementation, and management of data-driven dig...
digitaladsmarketingdigital marketinggooglecoordinatorfacebookspecialist

Customer Support
Smart Employment Services 0.00 to 4.00 Years Pune,Mumbai City 24 Mar, 2025

Job Title: International BPO Opportunities Were hiring for International BPO roles in Pune! Both freshers and experienced candidates are welcome to apply. Job Details: - Domain : Insurance, He...
international voice processinternational bpocustomer supportinbound processcustomer service

Customer Support Representative
Smart Employment Services 0.00 to 4.00 Years Pune,Mumbai City 24 Mar, 2025

Job Title: International BPO Opportunities Were hiring for International BPO roles in Pune! Both freshers and experienced candidates are welcome to apply. Job Details: - Domain : Insurance, He...
international voice processinternational bpobpo voicecustomer supportcommunication skills

Area Manager For Direct Sales Life Insurance
Niyukti Management Consultants 3.00 to 8.00 Years Noida,Delhi, Faridabad, Ghaziabad, Lucknow, Bhubaneswar, Kolkata, Gurugram, Chandigarh, Guwahati 24 Mar, 2025

Job Posting: Area Manager Direct Sales
Location: Delhi, Noida, ...
direct marketinginsurance salesbrokinglife insurancedirect channel salessalesrelationship managersales development managersales executive

Accounts & Admin Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 16.00 Years Mangalore,Hyderabad, Chennai, Bangalore, Other Karnataka, Noida, Gurugram, Kolkata, Mumbai City, Del 24 Mar, 2025

Our personal finance consultancy firm needs an Administrative Manager to take over administrative operations at our downtown location. We are looking for a highly organized and efficient profess...
auditingmanagementtimebudgetingreceivableanalysisaccountsreporting

Business Operations Analyst
Talish Solutions 5.00 to 10.00 Years Thane 24 Mar, 2025

We have an opening for Business Operations Analyst for our client (Healthcare Company) About the Company: Public Listed Company has been in the Healthcare bus...
business operations analystoperation analyst

Accounts & Admin Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 16.00 Years Mumbai City,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Mangalore, Delhi, Other Karnata 24 Mar, 2025

Our personal finance consultancy firm needs an Administrative Manager to take over administrative operations at our downtown location. We are looking for a highly organized and efficient profess...
auditingmanagementtimebudgetingreceivableanalysisaccountsreporting

Project Coordinator
DigiMantra Labs 0.00 to 3.00 Years Ludhiana,Other Punjab 24 Mar, 2025

Job Information Job Opening ID ZR_39_JOB Title Project Coordinator Date Opened 08/02/2024 Job Type Full time Industry IT Services Work Experience 0-1 year City Ludhiana State/Provin...
Project ManagementClient ManagementRisk ManagementCommunication SkillsMicrosoft OfficeProject Coordinator

Technical Training Facilitator
ODH DEVELOPERS PRIVATE LIMITED 10.00 to 20.00 Years Lucknow,Delhi, Other Uttar Pradesh, Oman, Morocco, Saudi Arabia, Bangalore, Tanzania, Kuwait, Sierra 24 Mar, 2025

We are looking for a Training Facilitator to prepare, coordinate and evaluate educational programs for our employees. Training Facilitator responsibilities include designing team and individual ...
serviceproblemcustomeranalyticalleadershipcommunicationskills

Human Resources Manager - India
TIME HOUSE 5.00 to 9.00 Years Kochi,Other Kerala 24 Mar, 2025

We are looking for an experienced and dynamic HR Manager to lead and oversee all human resources functions at our office in Cochin, India. The ideal candidate will be responsible for recruitment, ...
RecruitmentEmployee RelationsCompliancePerformance ManagementTalent AcquisitionWorkforce PlanningHR SoftwareHR Policy ImplementationEmployee Retention StrategiesPerformance Appraisal SystemsStatutory Requirements

Operations Manager
Gokul Oottupura Vegetarian Restaurant 5.00 to 9.00 Years Kochi,Other Kerala 24 Mar, 2025

1. Team Management and Leadership: Lead, motivate, and mentor restaurant managers and staff, fostering a positive and productive work environment. Provide guidance and support to restaurant team...
Team ManagementLeadershipBusiness DevelopmentCustomer ServiceConflict ResolutionFinancial AnalysisBudget ManagementComplianceSafety ManagementRecruitmentPerformance ManagementPreventive MaintenanceCommunication SkillsInterpersonal SkillsAnal

PREV
NEXT

house to house campaign Job Openings

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio... collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection

Job Posting: Area Manager Direct Sales

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Description Job Requirements Job Title Collection Manager-BIL, Personal Loan and MBL Functio...
collections processcollection strategyrecovery managementconsumer debtcollection managementcollection systemsdebt collection