oracle erp cloud jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

oracle erp cloud Job Openings

Showing 4051 - 4100 of 15074 Jobs

Appian Tech Lead

Best Infosystems Ltd Fresher Delhi 28 Sep, 2025

leadership

technical

SDE 2 - Backend

Saathi Fresher Delhi 28 Sep, 2025

objectoriented programming

software design principles

microservices architecture

caching strategies

Gold Loan Officer

Scalong AI Fresher Noida, Uttar Pradesh 28 Sep, 2025

SaaS Developer

Best Infosystems Ltd Fresher Chennai 28 Sep, 2025

development testing

development

AI/ML Python (Data Scientist)

Best Infosystems Ltd Fresher Chennai 28 Sep, 2025

Java Backend developer

MNR Solutions Pvt Ltd Fresher Bangalore, NoidaNoida, Mumbai City 28 Sep, 2025

Opening for SAP ABAP- HANA in Bangalore location

HARJAI COMPUTERS PRIVATE LIMITED Fresher Bangalore 28 Sep, 2025

ERP Functional Consultant

FinByz Tech Fresher Ahmedabad, Gujarat 28 Sep, 2025

testing

business process mapping

requirements gathering

ERP functional consulting

business requirements management

MBA Professor

GoldenJobs Placement Solutions Pvt Ltd Fresher Ahmedabad, GandhinagarGandhinagar, Vadodara, Gandhidham, Jamnagar, Rajkot, Bhuj, Gir, Bharuch, Bhavn 28 Sep, 2025

Professor MBA / MCA Position: Professor Departments: MBA / MCA <...
lecturer activitiesmba lecturermca lecturerassitant professor

Marketo

LTIMindtree Limited Fresher Pune 25 Sep, 2025

Marketo

Opportunity for AWS Cloud Architect Role in Pune

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune 25 Sep, 2025

aws

cloud

Senior Gen AI Engineer

Delta Sys-Tech (India) Pvt Ltd Fresher Hyderabad 25 Sep, 2025

Permanent job opening for Gen AI Engineer with US MNC organization at Hyderabad

machine learning

artificial intelligence

Adobe Analytics(dashboardSQL)

LTIMindtree Limited Fresher Hyderabad 25 Sep, 2025

Adobe Campaign

Technical Architect Associate

Chetu India Pvt Ltd Fresher Noida 25 Sep, 2025

Job Summary

Senior Software Engineer 2

C3 India Delivery Centre LLP (formerly known as Crowe Horwath IT Services LLP) Fresher Noida, Uttar Pradesh 25 Sep, 2025

Microsoft technology stack

Senior Software Development Engineer 2

SBS Fresher Noida, Uttar Pradesh 25 Sep, 2025

Digital transformation

Agile methodologies

Microservices architecture

Reactive programming

Enterprisegrade components

JD Edwards SND Consultant

LTIMindtree Limited Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 25 Sep, 2025

jde - distribution

jde

SAP Work Manager Developer

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

Adobe Analytics(dashboardSQL)

LTIMindtree Limited Fresher Chennai 25 Sep, 2025

Job Description

Adobe AnalyticsCampaign

Sales Development Representative

Live Connections Fresher Bangalore 25 Sep, 2025

business

sales development

sales department processes

Sr. Data Engineer (Azure Synapse)

Versent Systems Ltd Fresher Ahmedabad, Gujarat 25 Sep, 2025

Azure data engineering

Data technology

Data platform solutions

Presales Architects

Cloud Engineers

Azure data services

Problemsolving skills

Data pipelines

File f

MERN Stack Developer

Arihant HR Consultancy Fresher Ahmedabad 25 Sep, 2025

Develop and maintain end-to-end applications using MongoDB, Express.js, React.js, and Node.js.
Convert Figma/UI designs into responsive and interactive i...
restful apisawsnode.jsresponsive web designreact.jsexpress.js

Backend .NET Developer

AppleTech Fresher Vadodara, Gujarat 24 Sep, 2025

Microsoft Technologies

Verbal Communication

Written Communication

Microsoft Windows Platform

Cloud Technolog

JUNIOR JAVA DEVELOPER

Cueserve Fresher Vadodara, Gujarat 24 Sep, 2025

Machine Learning Engineer

Sunflower Lab Fresher Vadodara, Gujarat 24 Sep, 2025

MERN Full Stack Developer

Xcellence-IT Fresher Surat, Gujarat 24 Sep, 2025

Version control systems

Agile development methodologies

TypeScript

GraphQL

CICD

Senior React.js Developer

Inventam Tech Solution ( OPC ) Fresher Surat, Gujarat 24 Sep, 2025

Tech Lead

Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Functional specifications

Cost Center Accounting CCA

Profit Center Accounting PCA

Profitability Analysis CO

.NET Developer

FinJo Fresher Khordha 24 Sep, 2025

NET CoreNET Framework

ASPNET MVC

Web API

Entity FrameworkEF Core

RESTful services

presales consultant

BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Store Manager Dabur India Limited

sk online services Fresher Patna, BiharBihar, JammuKashmir, Gujarat, Madhya Pradesh, Ahmednagar, Jharkhand, Karnataka, Himachal 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Executive Chef
Tiffin Box Ranchi Fresher Ranchi, Jharkhand 24 Sep, 2025

The ideal candidate for this role is a seasoned chef who will be responsible for running an efficient kitchen. Your main tasks will include continually seeking ways to enhance the menu, ensuring t...
cheffinancial managementtrainingbudget constraintskitchen operations

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, Gujarat, Himachal Pradesh, JammuKashmir, Jharkhand, Karnataka, Madhya Pradesh, Ah 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Backe by DesignDgo Python Expert Senior Level
Inspire-I Solution Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Senior Python/Django Developer at our company based in Ahmedabad, India, you will be responsible for designing and building scalable backend solutions using Django, Python, and REST APIs. You...
PythonDjangoPostgreSQLMySQLOAuthGitDockerAWSGCPAzureRedisCeleryAngularREST APIsJWTCICD pipelinesReact

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Technical lead
Kalki Communication Technologies Fresher Kochi, Kerala 24 Sep, 2025

As a Technical Lead - Manual Testing, you will be responsible for leading a team of 4-6 members, preparing test plans, and developing test cases based on RTM. Your knowledge on IEC protocols, Linu...
Manual testingLinuxOracleSQL ServerMySQLTomcatJBossJIRABugzillaConfiguration ManagementWeb application testingIEC protocols

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Junior Finance Executive
Arbor Education Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Junior Finance Executive plays a crucial role within the finance team by supporting day-to-day operations, ensuring accuracy in financial transactions, and contributing to compliance and repor...
Financial operationsReportingComplianceIndian accounting standardsGSTTDSMS ExcelGoogle SheetsAccounting softwareAnalytical skillsWritten communicationVerbal communicationDirect tax rulesAttention to detailMonthend closingReconciliationsAud

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Site Reliability Developer 4
Oracle Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Network Reliability Engineering (NRE) team at Oracle Cloud is responsible for ensuring the robustness of the Oracle Cloud Network Infrastructure. As a Network Reliability Engineer, your primar...
Network EngineeringMPLSBGPIPv6DNSDHCPSSLData Center designPythonScriptingAutomationNetwork monitoringNETCONFVxLANEVPNTelemetry solutionsYANG

Python / Gen AI Developer
LION AND ELEPHANTS CONSULTANCY PRIVATE LIMITED Fresher Erode, CoimbatoreCoimbatore, Chennai, Tambaram, Pudukottai, Dindigul, Namakkal, Kumbakonam, Bangalor 24 Sep, 2025

Job Overview: We are looking for an experienced and passionate Python/Gen AI Developer to join our team in Coimbatore. The ideal candidate will have strong expe...
pythoncloud awsartificial intelligencedjangoflaskllmsgenerative ailanggraphpyspark

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, Gujarat, Himachal Pradesh, JammuKashmir, Jharkhand, Karnataka, Madhya Pradesh, Ah 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Workday HCM Consultant
BISP Solutions Fresher Bhopal, Madhya Pradesh 24 Sep, 2025

Role Overview: You will be responsible for providing Workday HCM consulting services at our Bhopal office. Your primary focus will be on Workday Recruiting, including implementation support rollou...
Business ProcessSDLCTeam LeadershipCompensationSecurityWorkday RecruitingAgile project methodologiesWorkday HCMOrg Structures

Spring Boot Developer with AWS for Bangalore, Hyderabad and Pune
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Pune, BangaloreBangalore, Hyderabad 23 Sep, 2025

We are hiring experienced Spring Boot Developers with AWS experti...
microservicesrest apiawskubernetesdockeraws lambdaaws rdsaws ec2cloud deployment

PREV
NEXT

oracle erp cloud Job Openings

Professor MBA / MCA Position: Professor Departments: MBA / MCA <... lecturer activitiesmba lecturermca lecturerassitant professor

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Professor MBA / MCA Position: Professor Departments: MBA / MCA <...
lecturer activitiesmba lecturermca lecturerassitant professor