presales jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

presales Job Openings

Showing 151 - 200 of 605 Jobs

Business Development Manager- SAAS Sales

BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Pune, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, 10 Oct, 2025

Business Development Manager- SAAS Sales

Experience:3 -15 Years

Salary - 6 LPA -12 LPA

Minimum- 3 Years Experience

...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Kolkata, GurugramGurugram, Mumbai City, Bhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Pune, Del 08 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Kolkata, GurugramGurugram, Mumbai City, Bhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Pune, Del 08 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

APM Presales Specialist
WINTECH SERVICES INDIA PRIVATE LIMITED Fresher Mumbai City 08 Oct, 2025

In-depth understanding of the challenges and requirements of various industries. Bachelors degree in computer science, Information Technology, or a related field (preferred). Be part of a forwa...
sqldynatracekubernetesdockerpythonbashappdynamicspresales

Inside Sales Manager
ONE5 KNOWLEDGE VENTURES PRIVATE LIMITED Fresher Delhi, Gurugram 08 Oct, 2025

Designations offered:Management Trainee/ Asst Manager/ Deputy Manager/ Manager Profile:B2B sales, pre sales mostly calling and corporate meetings, Inside sales,...
presalessales managementclient acquisitioninside salesclient handlingrelationship managementcorporate meetingsb2b salesmanagement trainee

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Pune, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, 05 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Hyderabad, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, 05 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Inside Sales at Andheri.
Job Search Hiring For IT Industry Fresher Mumbai City 03 Oct, 2025

Urgent job opening for Inside Sales (IT Industry) at Andheri. Qualifications * Excellent Communication * Bachelors degree or equivalent * 1 years previous In...
market researchinside salespresaleslead generation

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Gurugram, DelhiDelhi, Noida, Bhubaneswar, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 03 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Delhi, NoidaNoida, Bhubaneswar, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 03 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Pune, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Pune, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Mumbai City, PunePune, Bhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Delhi 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Presales Consultant
Hinduja Global Solutions Limited (HGS) Fresher Mumbai City 01 Oct, 2025

Job Description Associate/Senior Associate - Presales The Pre-sales, in an individual contributor role, will be responsible to support the sales team and other stakeholders at HGS (Business Ser...
sowrfqpresalesrfp

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Hyderabad, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Corporate Sales- Recruitment Services
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For Key Account Manager Fresher Hyderabad, BhubaneswarBhubaneswar, Gurugram 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA
Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Corporate Sales- Recruitment Services
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For Key Account Manager Fresher Gurugram, BhubaneswarBhubaneswar, Hyderabad 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA
Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Corporate Sales- Recruitment Services
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For Key Account Manager Fresher Bhubaneswar, HyderabadHyderabad, Gurugram 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA
Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Chennai, BhubaneswarBhubaneswar, Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Sr. Data Engineer (Azure Synapse)
Versent Systems Ltd Fresher Ahmedabad, Gujarat 25 Sep, 2025

Role Overview: As a Senior Data Engineer with 5 to 8 years of experience and expertise in Azure Synapse and deep Azure data engineering, you will be responsible for designing and implementing data...
Data ArchitectsData engineeringAnalytical skillsAPIsDatabasesAzure DevOpsAzure SynapseAzure data engineeringData technologyData platform solutionsPresales ArchitectsCloud EngineersAzure data servicesProblemsolving skillsData pipelinesFile f

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Business Development Consultant
Velodata Global Pvt Ltd Fresher Kochi, Kerala 24 Sep, 2025

As a Business Development Consultant for IT Services in Dubai, UAE, you will play a crucial role in expanding the companys presence in the region and beyond. Your primary responsibilities will inc...
Business DevelopmentIT servicesSales GrowthMarket TrendsLead GenerationMentoringPresalesMarketingCold CallingHubSpotIT SolutionsClient RelationshipsProposal PresentationsDeal Closing

Key Accounts Specialist Inside Sales
Topgear Consultants Private Limited Fresher Mumbai City 16 Sep, 2025

Job Title: Key Accounts Specialist Inside Sales Location: Bhandup (West), Mumbai HQ client acquisitionlead generationnegotiation skillsmarket researchclient relationship managementpresales

E-Commerce Business Analyst
Sigma Infosolutions Ltd Fresher Ahmedabad, Gujarat 11 Sep, 2025

You should have a minimum of 7 years of experience for the position located in Ahmedabad. Your responsibilities will include collecting, documenting, and analyzing requirements for both existing a...
DocumentationAnalysisProject ManagementClient InteractionPresalesProject EstimationRisk ManagementCustomer SatisfactionRequirement CollectionSolution Proposal

Product Owner/Business Analyst
Antier Solutions Fresher Punjab 09 Sep, 2025

About Antier Solutions Pvt Ltd: Antier Solutions Pvt Ltd is a global leader in providing innovative technology solutions, specializing in the Web3 space. We are passionate about enabling business...
Product ManagementAgile MethodologiesPresalesCommunication SkillsCustomer FocusProduct OwnershipWeb3 IndustryTechnical Acumen

Oracle CPQ Developer
LTIMindtree Limited Fresher Kolkata, Mumbai CityMumbai City, Bangalore, Noida, Chennai, Hyderabad, Pune 03 Sep, 2025

The Consultant should have 5 - 10 years of experience in Oracle CPQ Implementation and Support

Should have worked in all areas of Oracle CPQ

Product Configurator Co...
configurationoracleproblem solving

Organizational Change Management (OCM) Consultant
Wipro Limited Fresher Vadodara, Gujarat 03 Sep, 2025

Wipro Limited is a leading technology services and consulting company dedicated to creating innovative solutions that cater to the most complex digital transformation requirements of their clients...
ConsultingTrainingRisk AssessmentCommunication skillsMentoringERP consultingCustomer relationship managementOrganizational Change ManagementExecutiveStakeholder managementWorkshops facilitationPresales

Techno Commercial Manager for PEB Industry
PEB 360 Solutions Fresher Nagpur, Maharashtra 31 Aug, 2025

As a Techno Commercial Manager for the PEB Industry, you will play a crucial role in managing and executing the pre-sales process. Your responsibilities will include identifying customer needs, pr...
PreSalesCommunication skillsLead GenerationTechnical SupportSolution DesignFeasibility studiesCustomer EngagementBid ManagementMarket AnalysisTrainingDevelopmentDocumentationReportingManager of OperationsPEB systems

Oracle CPQ Developer
LTIMindtree Limited Fresher Kolkata, BangaloreBangalore, Noida, Chennai, Hyderabad, Pune, Mumbai City 22 Aug, 2025

The Consultant should have 5 - 10 years of experience in Oracle CPQ Implementation and Support

Should have worked in all areas of Oracle CPQ

Product Configurator Co...
configurationoracleproblem solving

Business Analyst (Healthcare Domain)
EINSATZ Technologies Fresher Kochi, Kerala 19 Aug, 2025

The ideal candidate for the Business Analyst position should have a strong sense of responsibility and a positive attitude. It is essential to possess excellent written and verbal communication sk...
Analytical skillsData analysisData EngineeringStrong analytical skillsDevOpsSQLGood writtencommunication skills in EnglishMalayalamHealthcare Application knowledgeUnderstanding of Clinical Data standardsHandson design experience with clinical r

Node JS Technical Lead
Tryzens Global Fresher Thiruvananthapuram, Kerala 16 Aug, 2025

You will play a crucial role in the fast-growing Commerce practice at Tryzens, contributing to the successful delivery of client projects. As a Technical Lead, your primary responsibility will be ...
MEAN stackHTMLCSS3SASSGITJIRAAngularSQLNoSQLAgile ScrumNode JSNodeJS microservicesReact JSREST APIs

Business Analyst - 2 to 4 Years - Noida
KSmart Software Staffing Solutions Fresher Noida, Uttar Pradesh 16 Aug, 2025

Job Brief We are seeking a Presales Consultant Responsibilities Must be able to communicate in English fluently Requirements Gathering: a. Work closely with stakeholders to elicit, analyze, an...
Requirements GatheringDocumentationCommunicationAnalysisCollaborationJIRAHTML

Presales Head - IT Infrastructure
H3 Technologies, LLC Fresher Mumbai City 04 Aug, 2025

Position Details & Responsibilities:

Own and execute plans to achieve order booking and revenue goals for the practice

Define Road Map for Technology rela...
closingsecurityit infrastructuresalesit servicescloudpresalesservercentercustomerdatafacing

Business Development Manager
Aufait UX Fresher Kozhikode, Kerala 28 Jul, 2025

As a Business Development Manager at our company, your primary responsibility will be to develop growth strategies, plans, and drive business growth. You will lead the sales team through the end-t...
customer relationship managementpipeline managementsales experiencesales targetsverbalwritten communication

Tele Sales Officer - Bankin
Wroots Global Private Limited Fresher Bangalore 18 Jul, 2025

Hiring forDomestic Tele-Sales - Banking Graduate Freshers can apply (Excellent communication) Should be flexible with shifts Work from Office UG freshers can also apply (Exce...
outbound salespersonal loanstelesalesbusiness loaninsuranceinbound salespresales

BDA Inside Sales - 5 LPA Unlimited Incentives
Aimlay Pvt Ltd ( Recruitment ) Fresher Delhi 16 Jul, 2025

Job Title: BDA Inside Sales (5 LPA (Fixed) Unlimited Incentives) Company: Aimlay Pvt. Ltd. Location: On-site Rohini, Delhi Department: Sales Employment Type: Full-time Salary: 5 LPA (Fixed...
Sales acumenCommunication skillsUpsellingSales presentationsClient interactionCrosssellingPresales discussionsCRM systemsTargetoriented

Inside Sales Representative | 5 LPA Unlimited Incentives
Aimlay Pvt Ltd ( Recruitment ) Fresher Delhi 16 Jul, 2025

Job Title: Inside Sales Representative | 5 LPA Unlimited Incentives Company: Aimlay Pvt. Ltd. Location: On-site Rohini, Delhi Department: Sales Employment Type: Full-time Salary: 5 LPA Unl...
SalesInside SalesPresalesCommunication SkillsUpsellingCrossselling

Business Analyst - 2 to 4 Years - Noida
KSmart Software Staffing Solutions Fresher Noida, Uttar Pradesh 14 Jul, 2025

Job Brief We are seeking a Presales Consultant Responsibilities Must be able to communicate in English fluently Requirements Gathering: a. Work closely with stakeholders to elicit, analyze, an...
Requirements GatheringDocumentationCommunicationAnalysisCollaborationJIRAHTML

Oracle CPQ Developer
LTIMindtree Limited 5.00 to 8.00 Years Bangalore, NoidaNoida, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 10 Jul, 2025

The Consultant should have 5 - 10 years of experience in Oracle CPQ Implementation and Support

Should have worked in all areas of Oracle CPQ

Product Configurator Co...
configurationoracleproblem solving

Oracle CPQ Developer
LTIMindtree Limited 5.00 to 8.00 Years Hyderabad, BangaloreBangalore, Noida, Chennai, Kolkata, Pune, Mumbai City 08 Jul, 2025

The Consultant should have 5 - 10 years of experience in Oracle CPQ Implementation and Support

Should have worked in all areas of Oracle CPQ

Product Configurator Co...
configurationoracleproblem solving

Inside Sales Representative | 5 LPA Unlimited Incentives
Aimlay Pvt Ltd ( Recruitment ) 2.00 to 6.00 Years Delhi 30 Jun, 2025

Job Title: Inside Sales Representative | 5 LPA Unlimited Incentives Company: Aimlay Pvt. Ltd. Location: On-site Rohini, Delhi Department: Sales Employment Type: Full-time Salary: 5 LPA Unl...
SalesInside SalesPresalesCommunication SkillsUpsellingCrossselling

Business Development Manager Instanodes
Antier Solutions 5.00 to 9.00 Years Chandigarh 24 Jun, 2025

About the Role: We are looking for a dynamic and driven Business Development Manager Instanodes to lead client acquisition, relationship building, and business expansion. The ideal candidate sho...
B2B SalesEnterprise SalesBlockchainSaaSNetworking SkillsWeb3Blockchain ArchitectureGotoMarket StrategiesTechnical Solutions

Techanical Sales Engineer
Legacy keepers 3.00 to 7.00 Years Raipur 22 Jun, 2025

Job Summary: We are seeking a skilled and results-driven Technical Sales Engineer to join our sales team. The ideal candidate will have a strong technical background coupled with sales acumen to ...
Technical SalesSales AcumenCustomer EngagementTechnical PresentationsCustomizationRFPsRFQsMicrosoft OfficeAccount ManagementPresales SupportPostsales SupportProduct DemonstrationsCRM ToolsPresentation Software

Technical & Solution Sales Support(5)
Ericsson 3.00 to 8.00 Years Haryana 17 Jun, 2025

Join our Team About This Opportunity We are now looking for a Technical Solution Sales Support to support the KAM organization with product and solution expertise on different levels in pre-sale...
ContainerizationNetworkingCCDCEEOpenStackVirtualizationStorageCloud SolutionTelco CloudNFVICNISHCP

Lead Data Scientist - AI/ML
Yash Technologies 8.00 to 12.00 Years Pune, Maharashtra 15 Jun, 2025

Date: May 14, 2025 Job Requisition Id: 60916 Location: Hyderabad, TG, IN Pune, MH, IN Pune, IN Indore, MP, IN YASH Technologies is a leading technology integrator specializing in helping client...
securityLangChainLangGraphembedding techniquesprompt engineeringXGBoostRandom ForestPython ML stackFastAPI

Techno Commercial Manager for PEB Industry
PEB 360 Solutions 4.00 to 8.00 Years Nagpur, Maharashtra 15 Jun, 2025

Position Title: Techno Commercial Manager for PEB Industry Location: Nagpur Experience:4-6 years in designing/detailing/administration Salary: 3,50,000 to 5,00,000 Should have experience as a ...
PreSalesLead GenerationTechnical SupportSolution DesignFeasibility StudiesCustomer EngagementBid ManagementMarket AnalysisTrainingDevelopmentDocumentationReportingManager of Operations

Cloud Solution Architect | 13- 20 Years
Capgemini 20.00 to 24.00 Years Noida, Uttar Pradesh 15 Jun, 2025

Job DescriptionSolution Architect Overall Experience- Minimum 20 years industry experience, strong in architecture principles- Skilled, experienced and expert on any one Hyperscaler (either Azure,...
AWSGCPAgile methodologiesDevOpsPresalesstrategic thinkingarchitecture principlesHyperscaler Azurecloud solutionsCustom Software Technology Stackintegration architecturesRFP responsesestimation models

Delivery Head - ServiceNow
Saaki Argus & Averil Consulting 14.00 to 20.00 Years Chennai, Tamil Nadu 15 Jun, 2025

Company Details: Our client is an Indian multinational information technology services and company. Our client delivers digital transformation and technology services from ideation to execution, e...
solutioningpresalesdeliverycapability buildingITSMITAMSNOWNetwork knowledge

Pre Sales Executive
Talisman Hr Solutions Private Limited 1.00 to 5.00 Years Mumbai City 15 Jun, 2025

Company Profile: Our client is a well-known real estate developer Job details: 110052 - Presales Executive- RI Experience: 1.0 Year(s) To 5.0 Year(s) Job Location: Mumbai Key Role: real estate salesoutbound callingoutbound salespresales

Tele Sales Officer - Bankin
Wroots Global Private Limited 0.00 to 3.00 Years Bangalore 15 Jun, 2025

Hiring forDomestic Tele-Sales - Banking Graduate Freshers can apply (Excellent communication) Should be flexible with shifts Work from Office UG freshers can also apply (Exce...
outbound salespersonal loanstelesalesbusiness loaninsuranceinbound salespresales

PREV
NEXT

presales Job Openings

Job description Identify and pursue new... business excellenceb2b salespresalescorporate salessaleslead generation

Job description Identify and pursue new... business excellenceb2b salespresalescorporate salessaleslead generation

Job description Identify and pursue new... business excellenceb2b salespresalescorporate salessaleslead generation

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation