cloud native concepts jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

cloud native concepts Job Openings

Showing 5201 - 5250 of 19279 Jobs

French Language Expert

IMPLEO CONSULTING Hiring For Impleo consulting Fresher Ahmedabad, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Chandigarh, Mumbai City, D 25 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY

What we are looking for & job description:

Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

Electrical Engineer & Mechanical Engineer
A-ONE STAFFING Fresher Ahmedabad, SuratSurat, Lucknow, Mumbai City, Delhi 25 Sep, 2025

Requirement Available

Post - Electrical Engineer, Mechanical Engineer

Required Experience - 1 yr to 3yr

Salary - 20,000 t...
power plantindustrialsitesite engineeringsite managementelectrical engineeringmachine designmechanical maintenanceelectrical designmechanical engineering

Backend .NET Developer
AppleTech Fresher Vadodara, Gujarat 24 Sep, 2025

As a Web Application Developer at AppleTechSoft, you will be required to have a minimum of 5 years of hands-on experience in developing web applications on the Microsoft Windows Platform and cloud...
Software DesignArchitectureREST APIOODAOPSQL ServerSQL QueriesJOINSDatabase DesignLINQDebuggingAnalytical SkillsJAVASCRIPTDOJODockerMicrosoft TechnologiesVerbal CommunicationWritten CommunicationMicrosoft Windows PlatformCloud Technolog

Service Engineer
CONCEPTS GLOBAL Fresher Vadodara, JaipurJaipur, Bangalore, Mumbai City 24 Sep, 2025

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation

Quality Assurance Automation Engineer (Mobile and Web)
Ventaja International Corp Fresher Vadodara, Gujarat 24 Sep, 2025

As a Senior QA Automation Engineer at Ventaja International Corp., you will play a crucial role in enhancing quality assurance practices across mobile and web platforms. Your primary responsibilit...
AppiumSeleniumTestNGJUnitPythonJavaJavaScriptJenkinsJMeterPostmanBrowserStackGitLab CI

Manufacturing Materials Procurement & Inventory Management Entry Professional
Hitachi Careers Fresher Vadodara, Gujarat 24 Sep, 2025

As a Factory Buyer at Hitachi Energy in Maneja-Vadodara, India, you will be an integral part of the Transformers Business Unit (BU) team. This team is dedicated to utilizing innovative technology ...
ProcurementSupply Chain ManagementVendor ManagementInventory ManagementCost OptimizationERPSAPLean ManufacturingKANBANVMIRisk EvaluationEngineering Drawing

Machine Learning Engineer
Sunflower Lab Fresher Vadodara, Gujarat 24 Sep, 2025

As a Machine Learning Engineer, you will be responsible for designing and implementing scalable machine learning models throughout the entire lifecycle - from data preprocessing to deployment. You...
PythonNumPySparkPandasScikitlearnTensorFlowPyTorchMLflowKubeflowDaskAWS SageMakerGCP AI PlatformWeightsBiasesDVCRay

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Vadodara, SuratSurat, Ahmedabad, Nashik, Indore, Kolkata, Aurangabad, Nagpur, Bhopal, Guwahati 24 Sep, 2025

We are seeking a dedicated machine learning engineer to join our team and work on cutting-edge AI projects. This role involves building data pipelines, designing ML models, and collaborating clos...
software testingtestinghardware testingquality

Web Content Writer
Tempsens Instruments (I) Pvt Ltd Fresher Udaipur, Rajasthan 24 Sep, 2025

As a Technical Content Writer at Tempsens located in Udaipur, Raj, you will play a crucial role in creating high-quality content for the companys website, blogs, and marketing materials. Your prim...
Keyword researchGoogle AnalyticsWritten communicationVerbal communicationSEOoptimized technical content writingContent marketing strategiesContent management systems CMS

React. JS Developer
Axone Infotech India Fresher Surat, Gujarat 24 Sep, 2025

As a React.js Developer with 1 to 5 years of experience, you will be a valuable member of our team responsible for developing and enhancing our modern web applications. Collaborating closely with ...
JavaScriptRESTful APIsSASSLESSGitReactjsReduxReact QueryCSS preprocessorsWebpack

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Surat, VadodaraVadodara, Nashik, Ahmedabad, Indore, Kolkata, Aurangabad, Nagpur, Bhopal, Guwahati 24 Sep, 2025

We are seeking a dedicated machine learning engineer to join our team and work on cutting-edge AI projects. This role involves building data pipelines, designing ML models, and collaborating clos...
software testingtestinghardware testingquality

MERN Full Stack Developer
Xcellence-IT Fresher Surat, Gujarat 24 Sep, 2025

You will be joining a dynamic and forward-thinking IT solutions company, Xcellence-IT, as a MERN Full Stack Developer. In this role, you will be responsible for designing, developing, and maintain...
JavaScriptHTML5CSS3MongoDBRESTful APIsWeb servicesAWSAzureMochaMERN stackExpressjsReactjsNodejsVersion control systemsAgile development methodologiesTypeScriptGraphQLCICD

Senior React.js Developer
Inventam Tech Solution ( OPC ) Fresher Surat, Gujarat 24 Sep, 2025

As a Senior React.js Developer at our innovative IT services company specializing in cutting-edge software solutions, you will be at the forefront of developing an advanced finance and trading app...
JavaScriptHTML5CSS3WebSocketsAWSAzureReactjsTypeScriptReduxMobXContext APIMaterial UIAnt DesignNextjsD3js

Laravel Developer
Param Software Fresher Rajkot, Gujarat 24 Sep, 2025

Role Overview: As a Full Stack Laravel Developer at Param Software, you will be responsible for designing, developing, and maintaining high-quality web applications using the Laravel framework. Yo...
PHPMySQLOOPHTMLCSSJavaScriptGitRESTful APIsAWSAzureLaravel frameworkVuejsReactMicroservices ArchitectureLaravel LivewireInertiajs

Tech Lead
Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Role Overview: STL Digital is seeking a talented SAP CO Consultant to join their team in Bhadrak. As a SAP CO Consultant, you will be responsible for leading or supporting SAP FICO module integrat...
Internal OrdersProduct CostingVariance AnalysisCost SheetFunctional specificationsUnit testingIntegration testingProduction supportIssue resolutionSAP CO ConsultantCost Center Accounting CCAProfit Center Accounting PCAProfitability Analysis CO

.NET Developer
FinJo Fresher Khordha 24 Sep, 2025

You are an accomplished .NET Developer with over 4 years of professional experience, responsible for designing, developing, and maintaining enterprise web applications at client project sites. You...
SQL ServerOOPSOLID principlesJavaScriptjQueryHTML5CSS3AzureAWSGitAgile methodologyNET CoreNET FrameworkASPNET MVCWeb APIEntity FrameworkEF CoreRESTful services

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Area Sales Manager (ASM)
ANYTHING SKOOL LIMITED Fresher Ranchi, Jharkhand 24 Sep, 2025

You will be joining as an Area Sales Manager with 4-7 years of experience in the Education Industry, focusing on School Marketing. Your educational qualifications should include an MBA in Marketin...
MarketingSchool MarketingCommunication SkillsPresentation SkillsAnalytical SkillsTeam HandlingMarket Study

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Senior 3D Artist
ChicMic Studios Fresher Punjab 24 Sep, 2025

Role Overview: You will be a skilled and imaginative 3D Artist joining our team, with a strong foundation in 3D modeling, texturing, and rendering. Your main responsibility will involve collaborat...
3D modelingtexturingrenderingBlenderMayaZbrushSubstance PainterUnreal EngineUnityMarvelous DesignerKeyshotanimationriggingMarmoset ToolbagRoblox

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Solar PV Installation & Maintenance Trainer
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Madurai, TiruchirappalliTiruchirappalli, Thanjavur, Erode, Coimbatore, Chennai, Salem, Sivakasi, Kri 24 Sep, 2025

Job Title: Solar PV Installation & Maintenance Trainer Location: Chennai solar pvstandardsmaintenanceinstallationprotocolssafetysolarsolar project field experience

Freelance Trainer - Python & Artificial Intelligence
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Madurai, TiruchirappalliTiruchirappalli, Erode, Coimbatore, Chennai, Thirunelveli, Salem, Dindigul, 24 Sep, 2025

Job Title: Freelance Trainer - Python & Artificial Intelligence Job Location: Based upon Projects ( Inside Tamil Nadu) Job type: Freelance /on-site We are hiring an experien...
natural language processingpandamachine learningnumpyflowpythonscikit-learndeep learningartificial intelligence

Content Marketing Executive
FlyMedia Technology -IT Company Fresher Ludhiana, Punjab 24 Sep, 2025

As a Content Strategist, you will play a crucial role in leading content planning and execution across various platforms. Your primary responsibility will be to develop engaging content strategies...
Campaign ConceptsAnalyticsContent StrategistContent PlanningContent ExecutionCrafting Engaging Content StrategiesWriting Core MessagingCollaboration with Creative TeamsContent CalendarsStorytelling FrameworksCompelling CopywritingBriefScript Pr

Alliance Executive
Taggd Fresher Ludhiana, Amritsar 24 Sep, 2025

Role & responsibilities

Executing tie-ups, Promotional Activities, and events in up metro markets.

Develop marketing initiatives to expand customer base and...
btl activationalliance managementoffline marketing

Sales Associate ( Noida )
CONSULTBAE INDIA PRIVATE LIMITED Fresher Lucknow, NoidaNoida, Kolkata 24 Sep, 2025

Position:Sales Associate (Sales & Ops) Exp:1 Years Working Mode:WFO, 5 Days Location:Noida,Kolkata, Lucknow Role ...
automobile salessales

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Software Developer (Full Stack)
EY Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: At EY, youll have the opportunity to build a unique career with global scale, support, inclusive culture, and technology to help you become the best version of yourself. Your unique...
SQLMicrosoft AzureAngularETL technologyMicrosoft Azure Data ServicesAzure Data FactoryDatabricksAzure Data Lake StoreDatabase conceptsData LakeWeb APIPowerBIPowerAppsPowerAutomatePMI

Executive Chef
Tiffin Box Ranchi Fresher Ranchi, Jharkhand 24 Sep, 2025

The ideal candidate for this role is a seasoned chef who will be responsible for running an efficient kitchen. Your main tasks will include continually seeking ways to enhance the menu, ensuring t...
cheffinancial managementtrainingbudget constraintskitchen operations

Service Engineer
CONCEPTS GLOBAL Fresher Jaipur, BangaloreBangalore, Mumbai City, Vadodara 24 Sep, 2025

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation

Backe by DesignDgo Python Expert Senior Level
Inspire-I Solution Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Senior Python/Django Developer at our company based in Ahmedabad, India, you will be responsible for designing and building scalable backend solutions using Django, Python, and REST APIs. You...
PythonDjangoPostgreSQLMySQLOAuthGitDockerAWSGCPAzureRedisCeleryAngularREST APIsJWTCICD pipelinesReact

French Language Expert
IMPLEO CONSULTING Hiring For Impleo consulting Fresher Ahmedabad, GurugramGurugram, Mumbai City, Bangalore, Noida, Hyderabad, Kolkata, Pune, Chandigarh, De 24 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY WORK FROM HOME { AS PER BUSINESS REQUIREMENT VOICE PROCESS } What we are looking for & job description: Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Site Reliability Developer 4
Oracle Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Network Reliability Engineering (NRE) team at Oracle Cloud is responsible for ensuring the robustness of the Oracle Cloud Network Infrastructure. As a Network Reliability Engineer, your primar...
Network EngineeringMPLSBGPIPv6DNSDHCPSSLData Center designPythonScriptingAutomationNetwork monitoringNETCONFVxLANEVPNTelemetry solutionsYANG

Solar PV Installation & Maintenance Trainer
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Erode, ThanjavurThanjavur, Madurai, Tiruchirappalli, Coimbatore, Chennai, Salem, Sivakasi, Krishnagi 24 Sep, 2025

Job Title: Solar PV Installation & Maintenance Trainer Location: Chennai solar pvstandardsmaintenanceinstallationprotocolssafetysolarsolar project field experience

Freelance Trainer - Python & Artificial Intelligence
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Erode, MaduraiMadurai, Tiruchirappalli, Coimbatore, Chennai, Thirunelveli, Salem, Dindigul, Krishnag 24 Sep, 2025

Job Title: Freelance Trainer - Python & Artificial Intelligence Job Location: Based upon Projects ( Inside Tamil Nadu) Job type: Freelance /on-site We are hiring an experien...
natural language processingpandamachine learningnumpyflowpythonscikit-learndeep learningartificial intelligence

Python / Gen AI Developer
LION AND ELEPHANTS CONSULTANCY PRIVATE LIMITED Fresher Erode, CoimbatoreCoimbatore, Chennai, Tambaram, Pudukottai, Dindigul, Namakkal, Kumbakonam, Bangalor 24 Sep, 2025

Job Overview: We are looking for an experienced and passionate Python/Gen AI Developer to join our team in Coimbatore. The ideal candidate will have strong expe...
pythoncloud awsartificial intelligencedjangoflaskllmsgenerative ailanggraphpyspark

Freelance Trainer - Python & Artificial Intelligence
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Coimbatore, ChennaiChennai, Thirunelveli, Madurai, Salem, Tiruchirappalli, Dindigul, Krishnagiri, Na 24 Sep, 2025

Job Title: Freelance Trainer - Python & Artificial Intelligence Job Location: Based upon Projects ( Inside Tamil Nadu) Job type: Freelance /on-site We are hiring an experien...
natural language processingpandamachine learningnumpyflowpythonscikit-learndeep learningartificial intelligence

Solar PV Installation & Maintenance Trainer
DIDYU TECHNOLOGIES PRIVATE LIMITED Fresher Coimbatore, ChennaiChennai, Thanjavur, Madurai, Salem, Tiruchirappalli, Sivakasi, Krishnagiri, Namak 24 Sep, 2025

Job Title: Solar PV Installation & Maintenance Trainer Location: Chennai solar pvstandardsmaintenanceinstallationprotocolssafetysolarsolar project field experience

French Language Expert
IMPLEO CONSULTING Hiring For Impleo consulting Fresher Chandigarh, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Ahmed 24 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY WORK FROM HOME { AS PER BUSINESS REQUIREMENT VOICE PROCESS } What we are looking for & job description: Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

French Language Expert
IMPLEO CONSULTING Hiring For Impleo consulting Fresher Chandigarh, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Ahmed 24 Sep, 2025

PLEASE READ COMPLETELY & THEN CALL/APPLY WORK FROM HOME { AS PER BUSINESS REQUIREMENT VOICE PROCESS } What we are looking for & job description: Fre...
french to englishenglish to frenchfrench languagefrench teacherc1 in frenchfrench language expertc 2 in frenchfrench language specialistnative language french

Fresher Internship Trainee(Live project trainee)
Guidance Placement Hiring For - Fresher Patna, GurugramGurugram, Jaipur, Gwalior, Noida, Kanpur, Delhi, Bhopal, Agra 24 Sep, 2025

Dear Candidate, We are excited to announce urgent openings for both freshers and experienced professionals in various fields. If you are interested in a live project trainee or internship opport...
react.jsandroidphpweb designingangular jslaravelweb developersoftware developersfull stack developer

Workday HCM Consultant
BISP Solutions Fresher Bhopal, Madhya Pradesh 24 Sep, 2025

Role Overview: You will be responsible for providing Workday HCM consulting services at our Bhopal office. Your primary focus will be on Workday Recruiting, including implementation support rollou...
Business ProcessSDLCTeam LeadershipCompensationSecurityWorkday RecruitingAgile project methodologiesWorkday HCMOrg Structures

Fresher Internship Trainee(Live project trainee)
Guidance Placement Hiring For - Fresher Bhopal, GwaliorGwalior, Jaipur, Noida, Kanpur, Gurugram, Delhi, Agra, Patna 24 Sep, 2025

Dear Candidate, We are excited to announce urgent openings for both freshers and experienced professionals in various fields. If you are interested in a live project trainee or internship opport...
react.jsandroidphpweb designingangular jslaravelweb developersoftware developersfull stack developer

Spring Boot Developer with AWS for Bangalore, Hyderabad and Pune
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Pune, BangaloreBangalore, Hyderabad 23 Sep, 2025

We are hiring experienced Spring Boot Developers with AWS experti...
microservicesrest apiawskubernetesdockeraws lambdaaws rdsaws ec2cloud deployment

PREV
NEXT

cloud native concepts Job Openings

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron... electronicslaminationphotocopiershreddersinstallation

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron... electronicslaminationphotocopiershreddersinstallation

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation