cloud storage jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

cloud storage Job Openings

Showing 4201 - 4250 of 16184 Jobs

Senior Software Engineer 2

C3 India Delivery Centre LLP (formerly known as Crowe Horwath IT Services LLP) Fresher Noida, Uttar Pradesh 25 Sep, 2025

Microsoft technology stack

Senior Software Development Engineer 2

SBS Fresher Noida, Uttar Pradesh 25 Sep, 2025

Digital transformation

Agile methodologies

Microservices architecture

Reactive programming

Enterprisegrade components

SAP Work Manager Developer

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

Adobe Analytics(dashboardSQL)

LTIMindtree Limited Fresher Chennai 25 Sep, 2025

Job Description

Adobe AnalyticsCampaign

Sales Development Representative

Live Connections Fresher Bangalore 25 Sep, 2025

business

sales development

sales department processes

Sr. Data Engineer (Azure Synapse)

Versent Systems Ltd Fresher Ahmedabad, Gujarat 25 Sep, 2025

Azure data engineering

Data technology

Data platform solutions

Presales Architects

Cloud Engineers

Azure data services

Problemsolving skills

Data pipelines

File f

MERN Stack Developer

Arihant HR Consultancy Fresher Ahmedabad 25 Sep, 2025

Develop and maintain end-to-end applications using MongoDB, Express.js, React.js, and Node.js.
Convert Figma/UI designs into responsive and interactive i...
restful apisawsnode.jsresponsive web designreact.jsexpress.js

Sous Chef

Tarasuns, A unit of Shree Ram Krupa Enterprise Fresher Vadodara, Gujarat 24 Sep, 2025

Social Media Marketing

Backend .NET Developer

AppleTech Fresher Vadodara, Gujarat 24 Sep, 2025

Microsoft Technologies

Verbal Communication

Written Communication

Microsoft Windows Platform

Cloud Technolog

Machine Learning Engineer

Sunflower Lab Fresher Vadodara, Gujarat 24 Sep, 2025

Anesthesiologist

ETHOS HR MANAGEMENT AND PROJECTS PVT LTD Fresher Vadodara, Anand 24 Sep, 2025

anesthesiology

anesthesia

MERN Full Stack Developer

Xcellence-IT Fresher Surat, Gujarat 24 Sep, 2025

Version control systems

Agile development methodologies

TypeScript

GraphQL

CICD

Senior React.js Developer

Inventam Tech Solution ( OPC ) Fresher Surat, Gujarat 24 Sep, 2025

Tech Lead

Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Functional specifications

Cost Center Accounting CCA

Profit Center Accounting PCA

Profitability Analysis CO

.NET Developer

FinJo Fresher Khordha 24 Sep, 2025

NET CoreNET Framework

ASPNET MVC

Web API

Entity FrameworkEF Core

RESTful services

DABUR INDIA LIMITED

SLN ENTERPRISES Fresher Bhubaneswar, CuttackCuttack, Jharsuguda, Paradeep, Puri, Rourkela, Sambalpur, Bangalore, Odisha, Him 24 Sep, 2025

Contact Person

73.03.48.90.92

Dabur India limited

Hiring for Ware house Supervisor for one of leading FMCG company. warehouse operationsoder processinginventory managementdispatchinventory controlcommunication skillswarehouse managementsupply chain managementdistribution management

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, JammuKashmir, Gujarat, Madhya Pradesh, Ahmednagar, Jharkhand, Karnataka, Himachal 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Logistics Officer
SHARMA ENTERPRISES Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Guntakal, Anantpur, Dhubri, Dibrugarh, Guwahati 24 Sep, 2025

We are looking for a detail-oriented and organized Logistics Officer to join our team. The Logistics Officer will be responsible for coordinating the transportation, storage, and distribution of ...
supply chain managementcustomer serviceinventory managementproblem solvingadaptabilitylogistics managementdelivery operationsteamwork

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Chef (Commi 2 level)
Citimart Departmental Store Fresher Kochi, Kerala 24 Sep, 2025

The job involves assisting Commi 1 and Chef de Partie in food preparation and cooking by preparing ingredients, maintaining kitchen cleanliness and hygiene, following food safety standards, and su...
food preparationculinary skillscooking techniqueskitchen equipment

Executive Chef
Tiffin Box Ranchi Fresher Ranchi, Jharkhand 24 Sep, 2025

The ideal candidate for this role is a seasoned chef who will be responsible for running an efficient kitchen. Your main tasks will include continually seeking ways to enhance the menu, ensuring t...
cheffinancial managementtrainingbudget constraintskitchen operations

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, Gujarat, Himachal Pradesh, JammuKashmir, Jharkhand, Karnataka, Madhya Pradesh, Ah 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Commis Chef 2
ALTSEO PRIVATE LIMITED Fresher Jaipur, BareillyBareilly, Jamnagar, Siliguri, Bhagalpur, Tiruchengode, Hosur, Kollam, Gangtok, Mumba 24 Sep, 2025

Key Responsibilities:

Assist in the preparation, cooking, and presentation of dishes under the guidance of senior chefs.

Ensure all ingredients are prepped a...
food safetykitchen managementhouse cleaningindian cuisinefood preparationguest handlingserviceindian curryinterpersonal communication

Backe by DesignDgo Python Expert Senior Level
Inspire-I Solution Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Senior Python/Django Developer at our company based in Ahmedabad, India, you will be responsible for designing and building scalable backend solutions using Django, Python, and REST APIs. You...
PythonDjangoPostgreSQLMySQLOAuthGitDockerAWSGCPAzureRedisCeleryAngularREST APIsJWTCICD pipelinesReact

Manager Research & Development (Agronomy)
McCain Foods Limited Fresher Mehsana, Gujarat 24 Sep, 2025

**** **Role Overview:** As the Manager Research & Development (Agronomy) at McCain in Mehsana, you will be responsible for new variety shortlisting, variety evaluation, and agronomic trials for ...
AgricultureHorticultureBreedingAgronomyApplied ScienceVariety TrialCrop Production

Machine Operator
Ikamate HR India Pvt Ltd Fresher Ahmedabad 24 Sep, 2025

Job Title : Machine Operator - Sandwich puf panel Job Location : Bavala, Ahemdabad Job Experience : 3 to 4 year Job Summery:...
cold storageice machinescold roomsmachine operatingammonia refrigerationrefrigeration plantfreezersmachine assemblypuff

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Full stack Developer- Angular
SE Mentor Solutions Fresher Kochi, Kerala 24 Sep, 2025

As a Frontend Developer with expertise in Angular and API development, you will be responsible for the following: - Creating reusable components, custom directives, decorators, and services to in...
AngularAPI developmentdesign patternsJavaScriptHTMLCSSAzureHealthcareBootstrapAzure DevOpsGitlabJenkinsRoutingPipesLINQNGRXTypeScriptFront EndUIAzure AppsIonicMaterial UITyped FormsPromise vs ObservablesRxJs OperatorsTask vs Thre

Site Reliability Developer 4
Oracle Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Network Reliability Engineering (NRE) team at Oracle Cloud is responsible for ensuring the robustness of the Oracle Cloud Network Infrastructure. As a Network Reliability Engineer, your primar...
Network EngineeringMPLSBGPIPv6DNSDHCPSSLData Center designPythonScriptingAutomationNetwork monitoringNETCONFVxLANEVPNTelemetry solutionsYANG

Python / Gen AI Developer
LION AND ELEPHANTS CONSULTANCY PRIVATE LIMITED Fresher Erode, CoimbatoreCoimbatore, Chennai, Tambaram, Pudukottai, Dindigul, Namakkal, Kumbakonam, Bangalor 24 Sep, 2025

Job Overview: We are looking for an experienced and passionate Python/Gen AI Developer to join our team in Coimbatore. The ideal candidate will have strong expe...
pythoncloud awsartificial intelligencedjangoflaskllmsgenerative ailanggraphpyspark

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, Gujarat, Himachal Pradesh, JammuKashmir, Jharkhand, Karnataka, Madhya Pradesh, Ah 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Workday HCM Consultant
BISP Solutions Fresher Bhopal, Madhya Pradesh 24 Sep, 2025

Role Overview: You will be responsible for providing Workday HCM consulting services at our Bhopal office. Your primary focus will be on Workday Recruiting, including implementation support rollou...
Business ProcessSDLCTeam LeadershipCompensationSecurityWorkday RecruitingAgile project methodologiesWorkday HCMOrg Structures

Spring Boot Developer with AWS for Bangalore, Hyderabad and Pune
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Pune, BangaloreBangalore, Hyderabad 23 Sep, 2025

We are hiring experienced Spring Boot Developers with AWS experti...
microservicesrest apiawskubernetesdockeraws lambdaaws rdsaws ec2cloud deployment

Network Engineer - NAC or TAC
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 23 Sep, 2025

Position: Network Engineer - NAC or TAC Pre-requisite - Candidate should be well versed with Networking concepts and he should have at least 4 to 5 years of experience. Keyword...
tacroutingnacswitchingengineer

SAP DRC Consultant
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Mumbai City 23 Sep, 2025

Job Title: SAP DRC Consultant
Location: Mumbai, Pune and Banglore Experience: 414yrs Job Type: Full-t...
drccompliancesaphubdocument

Mlops Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Noida, DelhiDelhi, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 23 Sep, 2025

Location- PAN India Grade- C1 to C2 Exp- 6 to 12 Years Key Responsibilities: 1. Design, implement, and maintain end-to-end ML pipelines for model training, evaluation, and deployment 2. Collabor...
machine learningdockerpythonpipelinedevopskubernetesmlopstensorflowpytorchci/cd

Stock Clerk
NEW ERA LIFE CARE PRIVATE LIMITED Fresher Mangalore, BhubaneswarBhubaneswar, Vizianagaram, Bhagalpur, Rajahmundry, Kottayam, Sivasagar, Sangru 23 Sep, 2025

Job Summary We are looking for an organized and efficient stock clerk to join our growing business. As a stock clerk, you will manage receiving, storage, and distribution of mat...
order processingreceiving inspectionpurchase ordersmerchandising supply chaininventory managementproduct knowledgeregulatory complianceshelf stockingmaintaining stock records

Oracle SCM - Associate 2
PwC Acceleration Center India Fresher Hyderabad, Telangana 23 Sep, 2025

A career in our Advisory Acceleration Centre is the natural extension of PwCs leading class global delivery capabilities. We provide premium, cost-effective, high-quality services that support pro...
InventoryProcurementMaintenanceSCORImplementing Planning CentralCosting modulesOracle CloudSupply Chain Business Processes

Risk Consulting Analyst 2 - Managed Security
RSM US LLP Fresher Hyderabad, Telangana 23 Sep, 2025

You will be joining RSM, a leading provider of professional services to the middle market globally, with a focus on instilling confidence in a world of change and enabling clients and employees to...
IT operationsSecurity monitoringActive directoryIP networkingAutomationServiceNowNetFlowThreat intelligenceMalware analysisCybersecurityCloud technologiesSIEM toolsStellar CyberHyas InsightDNS ProtectSentinel OneELK StackVirus totalShoda

Mlops Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Gurugram, DelhiDelhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 23 Sep, 2025

Location- PAN India Grade- C1 to C2 Exp- 6 to 12 Years Key Responsibilities: 1. Design, implement, and maintain end-to-end ML pipelines for model training, evaluation, and deployment 2. Collabor...
machine learningdockerpythonpipelinedevopskubernetesmlopstensorflowpytorchci/cd

Mlops Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 23 Sep, 2025

Location- PAN India Grade- C1 to C2 Exp- 6 to 12 Years Key Responsibilities: 1. Design, implement, and maintain end-to-end ML pipelines for model training, evaluation, and deployment 2. Collabor...
machine learningdockerpythonpipelinedevopskubernetesmlopstensorflowpytorchci/cd

Java Backend developer
MNR Solutions Pvt Ltd Fresher Noida, BangaloreBangalore, Mumbai City 23 Sep, 2025

Dear Candidates, Currently looking for a Java Backend developer hiring for a Singapore based MNC On direct payroll Exp-5years NP-Immediate to 25th Aug before location-Noida, Mumbai Bangalore 5 ...
gcpapimicroservicesno sql

PREV
NEXT

cloud storage Job Openings

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job Title: SAP DRC Consultant

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers