lead conversion specialist jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

lead conversion specialist Job Openings

Showing 10801 - 10850 of 40936 Jobs

Business Development Officer

ALK Staffing Solutions Pvt Ltd Fresher Rajkot, JamnagarJamnagar, Bhavnagar, Surat, Vadodara, Ahmedabad, Junagadh, Anand, Surendranagar, Meh 24 Sep, 2025

About Equitas Small Finance Bank

saving account

current account

Agency Manager

KKD Consulting Hiring For clients Fresher Surat, RajkotRajkot, Ahmedabad, Junagadh, Junagarh, Jamnagar, Vapi, Anand, Porbandar, Ankleshwar 24 Sep, 2025

Were Hiring: Agency Manager

Agency Manager

sales

business development

Assistant Store Manager & Sales Assistant (Retail Stores)

Jobs Territory Hiring For Virgio Fresher Surat 24 Sep, 2025

Type

Location

Compensation

About the Role

District Manager

MNR Solutions Pvt Ltd Fresher Surat, SurendranagarSurendranagar, Gujarat, Tamil Nadu, Chittorgarh, Rajasthan, Hosur, Mysore, Karna 24 Sep, 2025

farmers

district sales management

channel sales

dealer sales

Business Development Officer

ALK Staffing Solutions Pvt Ltd Fresher Rajkot, JamnagarJamnagar, Bhavnagar, Surat, Vadodara, Ahmedabad, Junagadh, Anand, Surendranagar, Meh 24 Sep, 2025

About Equitas Small Finance Bank

saving account

current account

Tech Lead

Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Functional specifications

Cost Center Accounting CCA

Profit Center Accounting PCA

Profitability Analysis CO

Head of Marketing

RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Cuttack, AustraliaAustralia, Canada, Muzzafarpur, Guwahati, Gwalior, Chennai, Rajkot, Netherlands, A 24 Sep, 2025

Job brief We are seeking a dynamic Head of Marketing to take charge of all marketing initiatives, including social media, digital campaigns, advertising, and creative projects. As the Head o...
product developmentmarketing managementbrand managementmarketing communicationmarketing strategymarketing research

presales consultant

BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Workfront Specialist Opportunity at Capgemini - PAN India location

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bhubaneswar, BangaloreBangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, De 24 Sep, 2025

fusion

development

Area Sales Manager (ASM)

ANYTHING SKOOL LIMITED Fresher Ranchi, Jharkhand 24 Sep, 2025

Area Sales Manager

EDIFFY Fresher Ranchi, PatnaPatna, Jharkhand, Bangalore, Chennai, Hyderabad, Kolkata, Delhi, Bihar, Guwahati 24 Sep, 2025

business development

sales

Product Manager for Dust Collection System

Spark & Ray Technocrats Private Limited Fresher Raipur 24 Sep, 2025

Mechanical Engineering

Instrumentation Engineering

Product Management

Dust Collection Systems

Store Manager Dabur India Limited

sk online services Fresher Patna, BiharBihar, JammuKashmir, Gujarat, Madhya Pradesh, Ahmednagar, Jharkhand, Karnataka, Himachal 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Assistant Sales Manager
Talent Leads HR Solutions Pvt Ltd Fresher Patna, RanchiRanchi, Bhubaneswar, Lucknow, Chandigarh, Bhopal 24 Sep, 2025

Job Description Description: Asst. Sales Manager Corporate and Private Sales Department: Sales && Business Development Experience Required: 5-6 years (Relevant Ex...
b2b saleschannel sales

Production Manager Dabur India Limited
SLN ENTERPRISES Fresher Patna, GwaliorGwalior, Indore, Jabalpur, Madhya Pradesh, Ujjain, Bhopal, Katni, Ratlam, Satna 24 Sep, 2025

Contact Person:73.03.48.90.92 ( Riya Sharma) Dabur India limited We are hiring a Production Manager managementproduction planningmanufacturingproduction managersprocess quality

Customer Support Specialist
SATOPRADHAN PRIVATE LIMITED Fresher Amritsar 24 Sep, 2025

At Satopradhan, we are looking forCustomer Support Specialistsfor providing exceptional service and support to customers. Required Skills & Qualifications : call center operationscustomer supportcall center managementtelecallingcustomer service

Lead Generation Specialist
HAPPY SQUARE OUTSOURCING SERVICES LIMITED Fresher Mohali 24 Sep, 2025

Total number of positions- 5

Female preferred

Timings 5:30 pm- 2:30 am

Cabs will be given - Tricity

Location- Mohali

Responsi...
international marketinglead generationinternational business

Alert Development Manager Insurance Salary upto-5Lac
Niyukti Management Consultants Fresher Amritsar, JalandharJalandhar, Ludhiana, Patiala, Chandigarh, Jaipur, Jodhpur, Karnal, Kurukshetra, Y 24 Sep, 2025

life Insurance Post- Sales Manager, Location Chandigarh,Karnal,Kurukshetra,Yamunanagar,AmritsarJalandhar,Ludhiana,Patiala,Jaipur,Jodhpur Salary- 4 lac Rimb Incentive Exp.3 To 14 In sales Th...
insurance salessalesrelationship managerbusiness managersales managersales officerterritory sales managerdevelopment manageragency manager

Make Up cum Salon Manager (Female)
Hair Raiserz Luxe Fresher Punjab 24 Sep, 2025

You are seeking a Professional Make Up Artist cum Salon Manager (Female Only) to oversee the day-to-day operations of the salon. Your responsibilities will include supervising staff, managing sche...
Developing Marketing StrategiesFinancial TransactionsMicrosoft OfficeMake Up ArtistSalon ManagerSupervising StaffManaging SchedulesMarketing ServicesMaintaining Financial RecordsManaging InventoryAddressing Customer ConcernsIndustry Trends

Alert Development Manager Insurance Salary upto-5Lac
Niyukti Management Consultants Fresher Amritsar, JalandharJalandhar, Ludhiana, Patiala, Chandigarh, Jaipur, Jodhpur, Karnal, Kurukshetra, Y 24 Sep, 2025

life Insurance Post- Sales Manager, Location Chandigarh,Karnal,Kurukshetra,Yamunanagar,AmritsarJalandhar,Ludhiana,Patiala,Jaipur,Jodhpur Salary- 4 lac Rimb Incentive Exp.3 To 14 In sales Th...
insurance salessalesrelationship managerbusiness managersales managersales officerterritory sales managerdevelopment manageragency manager

Production Manager
TALENTWISE STAFFING SOLUTIONS Fresher Punjab 24 Sep, 2025

Job Description
We are hiring a Production Manager to lead our...
solarproduction planningprocess qualityproduction managersmanufacturingassembly linemanager

Opportunity Agency Manager | Life Insurance
Niyukti Management Consultants Fresher Amritsar, JalandharJalandhar, Ludhiana, Patiala, Chandigarh, Jaipur, Karnal, Jodhpur, Kurukshetra, Y 24 Sep, 2025

Job Opportunity: Agency Manager | Life Insurance Locations: Chandigarh, Karnal, Kurukshetra, Yamunana...
salesinsurance salesbusiness managerrelationship managerterritory sales managersales officerarea sales managerdevelopment managersales manager

Inside Sales Executive
Planet Spark Fresher Mohali, DamanDiuDamanDiu, Chattisgarh, Kurung Kumey, Bangalore, Madhubani, Tirap, Changlang, Cachar, 24 Sep, 2025

Key Responsibilities:

Engage with qualified, high-intent leads and design a ...
business developmentsalesforceb2c salesinside salesnegotiation skillscommunication skillssalesinternational sales

Inside Sales Manager
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Mysore, ChennaiChennai, Bangalore, Madurai 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Business Process Optimization Manager
University of the People Fresher Mysore, Karnataka 24 Sep, 2025

As a Business Process Optimization Manager at University of the People (UoPeople), you will be responsible for leading and managing the optimization of business processes across the organization. ...
Business Process OptimizationProcess ImprovementLeadershipLeanSix SigmaBPMData AnalysisProject ManagementCommunication SkillsInterpersonal SkillsStrategic ThinkingAnalytical Abilities

Shopify Theme Developer
Akuna Technologies Fresher Mysore, Karnataka 24 Sep, 2025

The ideal candidate for this role should have a minimum of 2 years of experience in Shopify Development. You will be responsible for designing and developing custom Shopify Themes, working on both...
HTMLCSSJavaScriptShopify DevelopmentTheme DesignsLiquid TemplatesShopify App integrationsWeb design standards

District Manager
MNR Solutions Pvt Ltd Fresher Mysore, HosurHosur, Karnataka, Tamil Nadu, Gujarat, Chittorgarh, Rajasthan, Surat, Surendranagar, Er 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

Busiess Development Manager
Career Job Solution Hiring For Career job solution Fresher Madurai, CoimbatoreCoimbatore, Chennai, Salem, Kanyakumari, Bangalore, Kochi, Bellary, Kannur, Mysor 24 Sep, 2025

A rapidly expanding health insurer backed by global and domestic investors.

Employee base grew 154% since fy 20, now over 7,000 strong.

Targeting 10,000 C...
salesb2c saleslead generationdirect salesinsurance salesinsurance

Inside Sales Manager
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Madurai, ChennaiChennai, Bangalore, Mysore 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Sales Executive - Urgent Hiring
Planet Spark Fresher Madurai, AssamAssam, Bangalore, Ghaziabad, Hyderabad, Vishakhapatnam, East Siang, Mumbai City, Delhi 24 Sep, 2025

About Us: Planet Spark is reshaping the EdTech landscape by equipping kids and young adults with future-ready skills like public speaking, and more. Were on a mission t...
salesforcedomestic salescommunication skillsinternational salesnegotiation skillssales

Digital Marketing Specialist
Study Square Fresher Ludhiana, Punjab 24 Sep, 2025

Study Square is an international student placement consultancy providing comprehensive support to international students throughout their academic journey. From admission counseling to student vi...
SEOPPCSocial Media MarketingEmail MarketingContent MarketingDisplay AdvertisingGoogle AnalyticsAdWordsContent Management SystemsHTMLMarketing Automation Tools

Field Executive
Tiara Consultancy Services Fresher Ludhiana, ChennaiChennai, Chittoor, Vellore, Mathura, Sonipat, Agra 24 Sep, 2025

We need to hire 5 Sales Executives for each dealer location and should have a pipeline with double that number. Please ensure candidate details are ready one day in advance. Here are the candida...
field worksales supportb2b marketinglead managementmotorsbusiness-to-businessfield sales

Opportunity Agency Manager | Life Insurance
Niyukti Management Consultants Fresher Ludhiana, ChandigarhChandigarh, Jalandhar, Amritsar, Patiala, Jaipur, Karnal, Jodhpur, Kurukshetra, 24 Sep, 2025

Job Opportunity: Agency Manager | Life Insurance Locations: Chandigarh, Karnal, Kurukshetra, Yamunana...
salesinsurance salesbusiness managerrelationship managerterritory sales managersales officerarea sales managerdevelopment managersales manager

Business Development Exec FS Amritsar
McCain Foods Limited Fresher Ludhiana, Punjab 24 Sep, 2025

The Business Development Executive at Amritsar is a key role focused on achieving targets through exceptional execution and service at Food Service outlets. Your responsibilities will include mana...
Client HandlingCommercial ManagementTeam LeadershipSalesBusiness DevelopmentActivation Execution

Alert Development Manager Insurance Salary upto-5Lac
Niyukti Management Consultants Fresher Ludhiana, ChandigarhChandigarh, Jalandhar, Amritsar, Patiala, Jaipur, Jodhpur, Karnal, Kurukshetra, 24 Sep, 2025

life Insurance Post- Sales Manager, Location Chandigarh,Karnal,Kurukshetra,Yamunanagar,AmritsarJalandhar,Ludhiana,Patiala,Jaipur,Jodhpur Salary- 4 lac Rimb Incentive Exp.3 To 14 In sales Th...
insurance salessalesrelationship managerbusiness managersales managersales officerterritory sales managerdevelopment manageragency manager

Opportunity Agency Manager | Life Insurance
Niyukti Management Consultants Fresher Ludhiana, ChandigarhChandigarh, Jalandhar, Amritsar, Patiala, Jaipur, Karnal, Jodhpur, Kurukshetra, 24 Sep, 2025

Job Opportunity: Agency Manager | Life Insurance Locations: Chandigarh, Karnal, Kurukshetra, Yamunana...
salesinsurance salesbusiness managerrelationship managerterritory sales managersales officerarea sales managerdevelopment managersales manager

Sales Associate ( Noida )
CONSULTBAE INDIA PRIVATE LIMITED Fresher Lucknow, NoidaNoida, Kolkata 24 Sep, 2025

Position:Sales Associate (Sales & Ops) Exp:1 Years Working Mode:WFO, 5 Days Location:Noida,Kolkata, Lucknow Role ...
automobile salessales

Apply Now Sr. Business Development Manager (Elite Vertical)
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Lucknow, KanpurKanpur, Noida, Delhi, Ghaziabad, Jaipur, Chandigarh, Nagpur, Bhopal, Ahmedabad 24 Sep, 2025

Apply Now Sr. Business Development Manager (Elite Vertical) Industry: Life Insurance salesagency channelsr.managing partneragency manageragency development managersales managerbusiness development managerbusiness managerinsurance agency sales

Hiring Deputy Area Manager (IMF Channel | Life Insurance)
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Lucknow, KanpurKanpur, Varanasi, Noida, Delhi, Ghaziabad, Bhubaneswar, Kolkata, Gurugram, Faridabad 24 Sep, 2025

Were Hiring Deputy Area Manager (IMF Channel | Life Insurance) Industry: Life Insurance life insuranceagency managerassistant branch managersr.sales managerchief business managerunit sales managersales executiveassociates partner sourcingdistribution manager

Business Development role salary structure for 5 LPA (5 Lakh Per Annum)
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Lucknow, VaranasiVaranasi, Bareilly, Sitapur, Basti, Barabanki, Moradabad, Gurugram, Kolkata, Farida 24 Sep, 2025

Job Title: Agency Development Manager Business Development Company: Leading Life Insurance Company ...
life insurancedevelopmentsalesbusinessbusiness development managerrelationship managersr.sales manageragency development managerarea sales managersr.relationship manager

Opening Elite Business Manager (MEV) Life Insurance
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Lucknow, KanpurKanpur, Noida, Delhi, Bareilly, Ghaziabad, Jhansi, Gurugram, Chandigarh, Bhopal 24 Sep, 2025

Job Opening: Elite Business Manager (MEV) Life Insurance Industry: Life Insurance agency channeldeputy branch manager sourcingsr.managing partnerbusiness managersales managerinsurance agency salesagency development manageragency manager

Busiess Development Manager
Career Job Solution Hiring For Career job solution Fresher Kannur, KochiKochi, Madurai, Coimbatore, Bangalore, Chennai, Bellary, Salem, Kanyakumari, Mysore 24 Sep, 2025

A rapidly expanding health insurer backed by global and domestic investors.

Employee base grew 154% since fy 20, now over 7,000 strong.

Targeting 10,000 C...
salesb2c saleslead generationdirect salesinsurance salesinsurance

Urgent Hiring - Relationship Officer & Sr Relationship Officer
Skywings Advisors Private Limited Fresher Kannur, KochiKochi, Kottayam, Pathanamthitta, Thiruvanananthapuram, Thrissur, Ernakulam, Thiruvanant 24 Sep, 2025

We are Hiring for the leading Insurance Company for Bancassurance channel. Job Responsibilities:

Drive sales and achieve the sales target for the ass...
salesbfsifield salesbranch bankinginsurance salesloanscredit cards

Customer Officer
VERTEX SECURITIES LIMITED Fresher Kochi, Kerala 24 Sep, 2025

As a Customer Care Team Lead, your primary role will be to oversee and guide the customer care team to provide exceptional service through various communication channels like phone, email, and cha...
Customer service managementLeadershipTeam managementCommunicationStock market operationsProblemsolvingInterpersonal abilitiesTrading platforms

Pricing Specialist
HastenWay Shipping Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: You will be responsible for preparing competitive freight rates, handling rate negotiations, and coordinating with carriers and agents to secure the best possible deals. The ideal c...
NegotiationAnalytical SkillsCommunication SkillsMS OfficeCustomer Service

Delivery Manager
SHARMA ENTERPRISES Fresher Kochi, ThrissurThrissur, Kollam, Ernakulam, Idukki, Kozhikode, Palakkad, Thiruvanananthapuram, Wayan 24 Sep, 2025

We are looking for delivery manager oversees the planning, execution, and successful delivery of a project or product, ensuring it meets timelines, budget, and quality standards. They act as a ce...
team managementproblem solvingproject executionstakeholder managementrisk managementproject planningquality assurance

Field Sales Executive - BFSI
Sarika HR Solutions Fresher Kochi, Chennai 24 Sep, 2025

Job Purpose To offer customized insurance solution to the customers for all their financial needs and act as an interface between customer and company Responsibilities To direct sell to the cu...
banking salessellingfieldfield salessalesinsurance brokeragebankinginsurance salesinsurancefield collectionslife insurancestreet

SEO Specialist
Law Prep Tutorial Fresher Jodhpur, Rajasthan 24 Sep, 2025

You should have 2 to 6 years of experience to apply for the role of SEO Specialist at Law Prep Tutorial. As an SEO Specialist, you will be responsible for leading and implementing organic growth s...
SEOAnalytical skillsEdtechContentled SEOTechnical SEOOnpage implementationSearch intentContent hierarchySEO content frameworksSEO tools

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Relationship Officer - Banca
SkillLabs Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Execution specialist, your primary responsibility will be to analyze customer segmentation and sales trends to evaluate business potential. You will conduct training sessions at branch locat...
Customer segmentationRelationship managementService orientationTeam collaborationIssue resolutionSales experienceSales trends analysisCross sell opportunities identification

PREV
NEXT

lead conversion specialist Job Openings

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job Description

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m... market researchsales strategysales promotionsales administrationsalesmarketing

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m... market researchsales strategysales promotionsales administrationsalesmarketing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing