presales architects jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

presales architects Job Openings

Showing 851 - 900 of 3570 Jobs

Site Engineer (Construction)

Spotless Incorp Fresher Erode, Tamil Nadu 08 Oct, 2025

Team Handling

Good Communication

Strong understanding of products

Inside Sales Manager

ONE5 KNOWLEDGE VENTURES PRIVATE LIMITED Fresher Delhi, Gurugram 08 Oct, 2025

Designations offered:

Profile:

relationship management

corporate meetings

b2b sales

management trainee

Business Development Manager- SAAS Sales

BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Pune, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, 05 Oct, 2025

Business Development Manager- SAAS Sales

Experience:3 -15 Years

Salary - 6 LPA -12 LPA

Minimum- 3 Years Experience

...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Hyderabad, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, 05 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Senior Azure cloud developer
Confidential Fresher Kochi, ThiruvanananthapuramThiruvanananthapuram, Thiruvananthapuram, Kerala 05 Oct, 2025

Job Description Senior Azure Cloud Developer) Location:Kochi, Thiruvananthapuram, India Type:Full Time Salary:...
azure devopsazure

Inside Sales at Andheri.
Job Search Hiring For IT Industry Fresher Mumbai City 03 Oct, 2025

Urgent job opening for Inside Sales (IT Industry) at Andheri. Qualifications * Excellent Communication * Bachelors degree or equivalent * 1 years previous In...
market researchinside salespresaleslead generation

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Gurugram, DelhiDelhi, Noida, Bhubaneswar, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 03 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Delhi, NoidaNoida, Bhubaneswar, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 03 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Pune, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Pune, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Mumbai City, PunePune, Bhubaneswar, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Delhi 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Mumbai City, PunePune, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Delhi 01 Oct, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Presales Consultant
Hinduja Global Solutions Limited (HGS) Fresher Mumbai City 01 Oct, 2025

Job Description Associate/Senior Associate - Presales The Pre-sales, in an individual contributor role, will be responsible to support the sales team and other stakeholders at HGS (Business Ser...
sowrfqpresalesrfp

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Hyderabad, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Corporate Sales- Recruitment Services
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For Key Account Manager Fresher Hyderabad, BhubaneswarBhubaneswar, Gurugram 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA
Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Corporate Sales- Recruitment Services
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For Key Account Manager Fresher Gurugram, BhubaneswarBhubaneswar, Hyderabad 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA
Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Corporate Sales- Recruitment Services
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For Key Account Manager Fresher Bhubaneswar, HyderabadHyderabad, Gurugram 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA
Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Chennai, BhubaneswarBhubaneswar, Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Java Angular Fullstack Developer
Delta Sys-Tech (India) Pvt Ltd Fresher Pune, BangaloreBangalore, Chennai, Mumbai City 28 Sep, 2025

We are Hiring for Java Angular Full Stack Developer
Location:Bangalore, Chennai, Pune & Mumbai hibernatespringjavamicroservicesangularjavascriptfullstack developerjava developer

Sailpoint Developer
Ara Resources Private Limited Fresher Pune, BangaloreBangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 28 Sep, 2025

About the Company ARAs client is a global professional services company with leading capabilities in digital, cloud, and security. Combining unmatched experience and specialized skills across mo...
idnsailpoint

Senior Fullstack Developer
Wolters Kluwer Fresher Pune, Maharashtra 28 Sep, 2025

As a skilled developer, you will collaborate with a team to deliver end-to-end solutions, encompassing coding and defect fixes. Your focus will be on creating scalable solutions and collaborating ...
Object Oriented programmingMS SQLMySQLHTMLCSSJavaScriptjQueryAngularJSDesign patternsTest Driven DevelopmentTDDUnit testingCode coverageNUnitDebuggingSolution DesignApplication ArchitectureREST servicesNet FrameworkNET COREASPNet MVC

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Noida, DelhiDelhi, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Hyderabad, BangaloreBangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Gurugram, DelhiDelhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Genio OpenText ETL Developer
Best Infosystems Ltd Fresher Noida, BangaloreBangalore, Chennai, Hyderabad, Pune, Mumbai City 28 Sep, 2025

Genio OpenText ETL Developer_Full-Time_Pan India Job Title: Genio OpenText ETL Developer Job Type: Full-Time Experience: 4 -8 Years Location: Pan India Employment Type: Full-time We are looking...
genio opentext etl developerextract

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Hiring for Engineering Manager - PAN India
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bangalore, ChennaiChennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

Position: Engineering Manager / D1 Band Location: PAN India A...
pmpgenaiagentic

Technical Architect Associate
Chetu India Pvt Ltd Fresher Noida 25 Sep, 2025

Job Summary We are looking for a Technical Architect Associate who will assist in designing, developing, and implementing scalable technology solutions using AI/ML, Python, Java...
intelligencejavascriptpythonjava

Sr. Data Engineer (Azure Synapse)
Versent Systems Ltd Fresher Ahmedabad, Gujarat 25 Sep, 2025

Role Overview: As a Senior Data Engineer with 5 to 8 years of experience and expertise in Azure Synapse and deep Azure data engineering, you will be responsible for designing and implementing data...
Data ArchitectsData engineeringAnalytical skillsAPIsDatabasesAzure DevOpsAzure SynapseAzure data engineeringData technologyData platform solutionsPresales ArchitectsCloud EngineersAzure data servicesProblemsolving skillsData pipelinesFile f

Lead Data Engineer
Anblicks Fresher Ahmedabad, Gujarat 25 Sep, 2025

As a Senior Data Engineer, your role will involve developing scalable data pipelines using Microsoft Fabric. Your responsibilities will include: - Developing and managing data pipelines through M...
Version controlDocumentationSQLPythonMicrosoft FabricData pipelinesMicrosoft Fabric Data FactoryOneLakeMetadata taggingBatch trackingCICD integrationObservabilityAzure Data FactoryDatabricksSynapsePySparkData catalogingLineage

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Key Accounts Manager ( Ahmedabad )
NITCO LIMITED Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Key Account Manager at NITCO, your role will involve managing the companys most strategic customer accounts in the tiles, marble, and mosaic segments. Your responsibilities will include build...
Relationship ManagementSales GrowthAccount PlanningStrategic Account IdentificationFinancial Controls

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Business Development Consultant
Velodata Global Pvt Ltd Fresher Kochi, Kerala 24 Sep, 2025

As a Business Development Consultant for IT Services in Dubai, UAE, you will play a crucial role in expanding the companys presence in the region and beyond. Your primary responsibilities will inc...
Business DevelopmentIT servicesSales GrowthMarket TrendsLead GenerationMentoringPresalesMarketingCold CallingHubSpotIT SolutionsClient RelationshipsProposal PresentationsDeal Closing

Design Engineer AutoCAD & Solid Works (Civil)
Amensco Medical Technologies Pvt ltd Fresher Kerala 24 Sep, 2025

As a detail-oriented engineer, you will be responsible for preparing and reviewing detailed engineering drawings, 3D models, and layouts using AutoCAD and SolidWorks. You will also assist in the d...
AutoCADSolidWorksDesign calculationsAnalysisOptimizationComplianceDocumentation

Java Angular Fullstack Developer
Delta Sys-Tech (India) Pvt Ltd Fresher Chennai, BangaloreBangalore, Pune, Mumbai City 23 Sep, 2025

We are Hiring for Java Angular Full Stack Developer
Location:Bangalore, Chennai, Pune & Mumbai hibernatespringjavamicroservicesangularjavascriptfullstack developerjava developer

Site Incharge
SHARMA ENTERPRISES Fresher Vijayawada, GunturGuntur, Rajahmundry, Kakinada, Nellore, Kurnool, Tirupati, Vishakhapatnam, Guntaka 20 Sep, 2025

We are looking for site in-charge manages the day-to-day operations of a construction or project site, overseeing daily activities, coordinating resources and teams, ensuring adherence to safety ...
quality assuranceproblem solvingsafety managementproject managementcommunicationtechnical skillsorganizationleadership management

Area Sales Executive
dubond Fresher Rajkot, Gujarat 20 Sep, 2025

As a Sales Executive at our company, you will play a crucial role in driving sales and achieving targets. Your responsibilities will include developing and implementing effective sales strategies,...
Business DevelopmentMarketingNegotiationInterpersonal SkillsMS OfficeSales StrategiesNetworkingCold CallingMarket AnalysisCustomer ServiceSales ExecutiveConstruction Industry

.Net Core Product Team Lead
Distinct Infotech Solutions Fresher Kochi, Kerala 20 Sep, 2025

As an experienced and motivated .Net Core Product Team Lead, you will be responsible for leading and mentoring a team of backend developers for our Mobi Remit & Digi Remit platforms. Your deep tec...
SQL ServerDependency InjectionUnit TestingGitNET CoreNET 5RESTful API developmentMicroservices architectureOracle databasesNET Framework 48AgileScrum methodologies

Senior Specialist - Data Engineering
LTIMindtree Limited Fresher Bangalore 20 Sep, 2025

Job Description We are seeking an experienced Data Modeler with 7 to 12 years of experience to join our team. The ideal candidate will be responsible for designing implementing and supporting ...
Data Modeling

Key Accounts Specialist Inside Sales
Topgear Consultants Private Limited Fresher Mumbai City 16 Sep, 2025

Job Title: Key Accounts Specialist Inside Sales Location: Bhandup (West), Mumbai HQ client acquisitionlead generationnegotiation skillsmarket researchclient relationship managementpresales

Openstack Admin
ITSOURCE GLOBAL SERVICES PRIVATE LIMITED Fresher Pune 15 Sep, 2025

Hi , We have hiring .kindly find the attached Job Description for the post of Openstack Admin in Tech Mahindra . If you have any Query you can call or WhatsApp on hidden_m...
linux administrationbash scriptingpython

Area Sales Manager - Project sales (Building material)
Glan jobs Fresher Ludhiana, DelhiDelhi, Noida 15 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Area Sales Manager - Project Sales (Building Material) to join our team. This role is pivotal in driving sales g...
tileslaminate flooringwall panelsarea salessalesproject sales

GCP Solution Architect
LTIMindtree Limited Fresher Kolkata, GurugramGurugram, Mumbai City, Bangalore, Noida, Chennai, Hyderabad, Pune, Delhi 11 Sep, 2025

Title: GCP Solution Architect Location : All LTIM Exp: 16-22 years Key Responsibilities

Soluti...
solution architecturecloud

Audit Executive
Design Creation Fresher Ranchi, Jharkhand 11 Sep, 2025

The Audit Executive position based in Ranchi requires a minimum of 3 years of experience in Internal Audit, with 3 years of articleship. The ideal candidate should have experience in internal audi...
Internal auditauditingaccountingincome tax

Azure Cloud Infrastructure Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Mumbai City 11 Sep, 2025

We are looking for an experienced Azure Cloud Infrastructure Engineer responsible for ensuring project and product teams implement lean, robust, and secure IT service infrastructure. The role inv...
paassaasazureinfrastructure

Project Manager Highrise
HR JOBS CONSULTANCY Fresher Bhubaneswar, IndoreIndore, Noida, Lucknow, Barmer, Durgapur 11 Sep, 2025

Project Manager Highrise Job Description Roles and Responsibilities Responsible for Delivery in time, Safety, Quality and cost. Determine and define scope of...
project managementproject coordinationproject engineering

Azure Cloud Infrastructure Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Mumbai City, PunePune, Bangalore 11 Sep, 2025

We are looking for an experienced Azure Cloud Infrastructure Engineer responsible for ensuring project and product teams implement lean, robust, and secure IT service infrastructure. The role inv...
paassaasazureinfrastructure

PREV
NEXT

presales architects Job Openings

Job description Identify and pursue new... business excellenceb2b salespresalescorporate salessaleslead generation

Job description Identify and pursue new... business excellenceb2b salespresalescorporate salessaleslead generation

Job description Identify and pursue new... business excellenceb2b salespresalescorporate salessaleslead generation

We are Hiring for Java Angular Full Stack Developer

We are Hiring for Java Angular Full Stack Developer

Position Overview We are seeking a dynamic and results-driven Area Sales Manager - Project Sales (Building Material) to join our team. This role is pivotal in driving sales g... tileslaminate flooringwall panelsarea salessalesproject sales

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Job description

Identify and pursue new...
business excellenceb2b salespresalescorporate salessaleslead generation

Position Overview We are seeking a dynamic and results-driven Area Sales Manager - Project Sales (Building Material) to join our team. This role is pivotal in driving sales g...
tileslaminate flooringwall panelsarea salessalesproject sales