aosp code base jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

aosp code base Job Openings

Showing 4401 - 4450 of 19155 Jobs

MERN Full Stack Developer

Xcellence-IT Fresher Surat, Gujarat 24 Sep, 2025

Version control systems

Agile development methodologies

TypeScript

GraphQL

CICD

Senior React.js Developer

Inventam Tech Solution ( OPC ) Fresher Surat, Gujarat 24 Sep, 2025

Node.js Developer

R K Infotech Fresher Rajkot, Gujarat 24 Sep, 2025

.NET Developer

FinJo Fresher Khordha 24 Sep, 2025

NET CoreNET Framework

ASPNET MVC

Web API

Entity FrameworkEF Core

RESTful services

presales consultant

BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Vacancy for Machine Learning Engineer

DEVIKA STAFFING SOLUTION Fresher Raipur, BhubaneswarBhubaneswar, Cuttack, Jaipur, Sikar, Jodhpur, Kota, Udaipur, Ranchi, Bikaner 24 Sep, 2025

Development Manager For Direct Sales Life Insurance

Niyukti Management Consultants Fresher Patna, KolkataKolkata, Bhubaneswar, Noida, Ghaziabad, Lucknow, Gurugram, Faridabad, Chandigarh, Delh 24 Sep, 2025

To generate The Business Through Direct Sales.
Comp. Gives you LeadFor Direct Channel.
Salar...
direct marketinglife insurancesalesdirect channel salessales development managerrelationship managerassistant sales managerrelationship officerunit manager

Development Manager For Direct Sales Life Insurance
Niyukti Management Consultants Fresher Patna, KolkataKolkata, Bhubaneswar, Noida, Ghaziabad, Lucknow, Gurugram, Faridabad, Chandigarh, Delh 24 Sep, 2025

Area Manager For Direct Sales

To generate The Business Through Direct Sales.

Comp. Gives you LeadFor Direct Channel.

Salar...
direct marketinglife insurancesalesdirect channel salessales development managerrelationship managerassistant sales managerrelationship officerunit manager

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Pondicherry, CoimbatoreCoimbatore, Chennai, Bangalore, Bidar, Vellore, Gulbarga, Hosur, Mangalore, S 24 Sep, 2025

Machine learning engineers are IT programmers who create software that provides computers and machines with the ability to function, learn and improve on their own (without being directed by huma...
testingsoftware testinghardware testingmanual testing

Dot Net Developer
Ariel Software Solutions Fresher Punjab 24 Sep, 2025

You have an exciting opportunity to join our team as a Software Developer in Mohali, Punjab. With 1 to 4 years of experience, you will be responsible for creating top-quality applications and mana...
NETHTMLCSSJavaScriptAJAXjQueryBootstrapAngularJSSQL ServerMYSQLMongoDBPostgreSQLAutofacUnityNinjectNUnitXUnitMSTestNET languages CNET framework MVCNETWeb APIReactJSNET 45Net CoreEntity Framework 6EF CoreNHibernateADONETDepende

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Territory Sales Manager
Confidential Fresher Madurai 24 Sep, 2025

Role & Responsibilities We are looking for a Software Engineer with 3 to 6 years of experience in developing, configuring, and customizing Product Lifecycle Management (PLM) sol...
javascriptrallyautomationjirarobotseleniumgoodpycharmtestingpythonframework

Siddha and Homeopathy
CORE 2 CODE Hiring For C2C Healthcare Fresher Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Salem, Cuddalore 24 Sep, 2025

Dear candidate I am Lavanya HR at C2C Healthcare We are hiring 50 -100 Siddha and Homeopathy candidate for the position of Junior Medical Coders Eligibility Siddha and Homeopathy 2019 - 2025...
anatomycommunication skillsenglishinterpersonal skills

Busiess Development Manager
Career Job Solution Hiring For Career job solution Fresher Madurai, CoimbatoreCoimbatore, Chennai, Salem, Kanyakumari, Bangalore, Kochi, Bellary, Kannur, Mysor 24 Sep, 2025

A rapidly expanding health insurer backed by global and domestic investors.

Employee base grew 154% since fy 20, now over 7,000 strong.

Targeting 10,000 C...
salesb2c saleslead generationdirect salesinsurance salesinsurance

Area Business Manager
Lactinova Nutrition PvtLtd Fresher Ludhiana, Punjab 24 Sep, 2025

You will be responsible for developing the potential market for Cattle Feed, establishing a distribution network in targeted markets, tracking purchase and sales channel partners, creating awarene...
SalesMarketingMarket AnalysisTeam ManagementCustomer ServiceBusiness DevelopmentSales StrategiesBudgeting

Business Development Exec FS Amritsar
McCain Foods Limited Fresher Ludhiana, Punjab 24 Sep, 2025

The Business Development Executive at Amritsar is a key role focused on achieving targets through exceptional execution and service at Food Service outlets. Your responsibilities will include mana...
Client HandlingCommercial ManagementTeam LeadershipSalesBusiness DevelopmentActivation Execution

Alliance Executive
Taggd Fresher Ludhiana, Amritsar 24 Sep, 2025

Role & responsibilities

Executing tie-ups, Promotional Activities, and events in up metro markets.

Develop marketing initiatives to expand customer base and...
btl activationalliance managementoffline marketing

Hiring Deputy Area Manager (IMF Channel | Life Insurance)
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Lucknow, KanpurKanpur, Varanasi, Noida, Delhi, Ghaziabad, Bhubaneswar, Kolkata, Gurugram, Faridabad 24 Sep, 2025

Were Hiring Deputy Area Manager (IMF Channel | Life Insurance) Industry: Life Insurance life insuranceagency managerassistant branch managersr.sales managerchief business managerunit sales managersales executiveassociates partner sourcingdistribution manager

Busiess Development Manager
Career Job Solution Hiring For Career job solution Fresher Kannur, KochiKochi, Madurai, Coimbatore, Bangalore, Chennai, Bellary, Salem, Kanyakumari, Mysore 24 Sep, 2025

A rapidly expanding health insurer backed by global and domestic investors.

Employee base grew 154% since fy 20, now over 7,000 strong.

Targeting 10,000 C...
salesb2c saleslead generationdirect salesinsurance salesinsurance

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

FIRMWARE ENGINEER
Z-Crossing Solutions Fresher Kochi, Kerala 24 Sep, 2025

As a Firmware Engineer, you will be responsible for supporting the firmware development team in the design, development, and production of firmware-supported products. Your role will involve testi...
RTOSMSP430SPIUARTI2CIARKeilMPLABZigbeeModbusProfibusLinux DriverKernelSVNGitHubHardware DebuggingCROEmbedded FirmwareSTM32IMXPIC32 MicrocontrollerCode ComposerLoRaSigfoxFoundation Field Bus ProtocolJetson NanoXavierTI Sitara S

Junior Angular Developer
HighQ-Labs Pvt Ltd Fresher Kochi, Kerala 24 Sep, 2025

You will be responsible for developing and maintaining code in accordance with predefined cost, company, and security standards. Your role will involve working on bug fixes, supporting the mainten...
rest apiSQLMongoDBsoftware programmingHTMLCSSAngular 2Hibernate Java

Export Sales Manager - Commodity
The Talent Quest Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Assistant Manager - Sales at our company, you will be responsible for managing client interactions, increasing sales, and ensuring smooth export procedures. Your primary duties will include ...
SalesMarket ResearchRelationship ManagementExport KnowledgeCommodities Trading

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Jodhpur, UdaipurUdaipur, Jaipur, Sikar, Kota, Bikaner, Bhubaneswar, Cuttack, Raipur, Ranchi 24 Sep, 2025

Machine learning engineers are responsible for putting data into machine learning models and deploying these models in production. Ingestion and preparation of data is a tricky task. It must be a...
software testingtestinghardware testingquality

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Ranchi, BhubaneswarBhubaneswar, Cuttack, Jaipur, Sikar, Raipur, Jodhpur, Kota, Udaipur, Bikaner 24 Sep, 2025

Machine learning engineers are responsible for putting data into machine learning models and deploying these models in production. Ingestion and preparation of data is a tricky task. It must be a...
software testingtestinghardware testingquality

Building Electrician
SHARMA ENTERPRISES Fresher Gwalior, IndoreIndore, Bhopal, Jabalpur, Kochi, Kozhikode, Kolkata, Ahmednagar, Palakkad, Kannur 24 Sep, 2025

We are currently searching for Building electrician to join our team. You will be responsible for installing and repairing complex electrical control, wiring, and lighting systems working from a ...
electrical testingblueprint readingtime managementelectrical safetycustomer serviceelectrical maintenanceelectrical troubleshootingcommunicationelectrical installation

Plant Human Resources Manager
MTC Group Fresher Gujarat 24 Sep, 2025

You will be joining a prestigious company, MTC Group, a prominent Conglomerate specializing in Metal Recycling, Trading, and Manufacturing operations, with its headquarters located in Mumbai, Indi...
RecruitmentAttendance ManagementSalary ProcessingWage AdministrationStatutory ComplianceEmployee RelationsEmployee Database ManagementGeneral AdministrationMonthly MISLeaveAbsenteeism ManagementLiasoning with Govt DepartmentsHR Legal Compliance

Frontend Developer - Reactjs
Webential Technologies Pvt Ltd Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Frontend Developer at Webential Technologies in Ahmedabad, you will be responsible for designing, developing, and implementing scalable web applications from front to back. You should have 2 ...
JavaScriptDOMGitReactjsNextjsHTML5CSSTypescriptBrowser EventsJavaScript APIsCanvas renderingBabelPostCSSWebpack

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Lead I - SE - React.Js, Typescript, Javascript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Front-End Developer with 7 years of experience, you will be responsible for developing modern, responsive, and high-performance web applications. Your primary focus will be on ...
JavascriptReactJsTypescript

Busiess Development Manager
Career Job Solution Hiring For Career job solution Fresher Kannur, KochiKochi, Madurai, Bangalore, Chennai, Bellary, Salem, Kanyakumari, Mysore, Coimbatore 24 Sep, 2025

A rapidly expanding health insurer backed by global and domestic investors.

Employee base grew 154% since fy 20, now over 7,000 strong.

Targeting 10,000 C...
salesb2c saleslead generationdirect salesinsurance salesinsurance

Software Developer (.Net)
BlueSeven Technologies LLC Fresher Kochi, Kerala 24 Sep, 2025

BlueSeven Technologies LLC, a Dubai based company owned by ATS Travel, a leading Travel Management Company with over 40 years of experience in providing comprehensive travel solutions to corporate...
NETSQL ServerWCFAngularJSJavaScriptjQueryOOPsMicrosoft SQL ServerGitASPNet MVCASPNet CoreWeb API

React Developer
Navalt Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: As a React Developer, you will be responsible for creating, implementing, and maintaining high-quality user interfaces and application components. You should have at least 4 to 5 ye...
JavaScriptAPIsGitDebuggingTroubleshootingCommunication skillsReactjsReduxDOM manipulationReactjs workflowsData structure librariesAuthorization mechanismsFrontend building pipelines

Frontend Developer (React Js)
Soxo Fresher Kozhikode, Kerala 24 Sep, 2025

You will be joining our Front End Team as an experienced candidate, with a minimum of 1 years of relevant experience, to contribute to the growth of our product team. Your role will involve: - De...
HTML5CSS3JavaScriptLESSSASSPolymerGitCSS in JSReactAngular 4VueES6WebpackParcelJS

Retail Store Manager
The Sleep Company Fresher Thrissur, Kerala 24 Sep, 2025

Role Overview: As the Store Manager, your main responsibility will be to oversee the daily operations of the store, ensuring smooth and efficient workflows. Your primary objective is to lead and i...
Retail ManagementInventory ManagementCustomer ServiceCommunication SkillsInterpersonal SkillsAdaptabilitySales TechniquesPointofSale Systems

Nutrition and Dietetics
CORE 2 CODE Hiring For Medcal coder Fresher Erode, ChennaiChennai, Salem, Dharmapuri, Pondicherry, Karaikal 24 Sep, 2025

Greetings from Core2Code Healthcare.!! Requirement: We are seeking candidates for the role of Medical Coder, ideal for freshers or those with prior exp...
nutritionbiochemistry

Siddha and Homeopathy
CORE 2 CODE Hiring For C2C Healthcare Fresher Coimbatore, ChennaiChennai, Madurai, Salem, Tiruchirappalli, Cuddalore 24 Sep, 2025

Dear candidate I am Lavanya HR at C2C Healthcare We are hiring 50 -100 Siddha and Homeopathy candidate for the position of Junior Medical Coders Eligibility Siddha and Homeopathy 2019 - 2025...
anatomycommunication skillsenglishinterpersonal skills

Development Manager For Direct Sales Life Insurance
Niyukti Management Consultants Fresher Chandigarh, BhubaneswarBhubaneswar, Noida, Ghaziabad, Lucknow, Gurugram, Kolkata, Faridabad, Delhi, 24 Sep, 2025

Area Manager For Direct Sales

To generate The Business Through Direct Sales.

Comp. Gives you LeadFor Direct Channel.

Salar...
direct marketinglife insurancesalesdirect channel salessales development managerrelationship managerassistant sales managerrelationship officerunit manager

Spring Boot Developer with AWS for Bangalore, Hyderabad and Pune
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Pune, BangaloreBangalore, Hyderabad 23 Sep, 2025

We are hiring experienced Spring Boot Developers with AWS experti...
microservicesrest apiawskubernetesdockeraws lambdaaws rdsaws ec2cloud deployment

Sap Technical Consultant
Evoke HR Solutions Pvt Ltd Fresher Pune, BangaloreBangalore, Chennai, Noida, Kolkata, Delhi 23 Sep, 2025

Job description Job Title: SAP ABAP, S4 Hana Experience: 7 to 9 Years Location: Any UST Location in India Employment Type: Full-Time Must Have: Strong hands-on...
hanasap abapamdp

Apps Dev Programmer Analyst 2
Early Career Fresher Pune, Maharashtra 23 Sep, 2025

The Applications Development Programmer Analyst position at our company involves participating in the establishment and implementation of new or revised application systems and programs in coordin...
JavaSpringSQLHibernateJunitSpringBoot

Software Engineer - React
Corpay Fresher Nagpur, Maharashtra 23 Sep, 2025

Your role will involve working as a Software Engineer specializing in React with a minimum of 3 years of experience. You will be responsible for developing and maintaining responsive web applicati...
JavaScriptHTML5CSS3RESTful APIsGitWCAGReactJSReact HooksContext APIReduxWebpackViteBabelJestReact Testing LibraryTypeScriptNextjsCICD pipelines

Diagnostic Specialist
DOMNIC LEWIS PRIVATE LIMITED Fresher Nagpur, Ahmedabad 23 Sep, 2025

As the Medical Affairs Diagnostic Executive, you will leverage your current medical, diagnostic and clinical test experience that will make an impact within a large, global pharmaceutical company...
diagnosticsclinical laboratory managementapplicationclinical laboratory improvement amendmentsmolecular diagnostics

BRANCH MANGER
Yes Bank Ltd Fresher Mumbai City 23 Sep, 2025

ROLE To lead and manage the retail branch operations, ensuring achievement of business targets, superior customer service, compliance with regulatory norms, and development of ...
branch managementbranch handlingbranch administrationretail branch banking

Salesforce Developer Level 2
IntraEdge Fresher Hyderabad, Telangana 23 Sep, 2025

As a Salesforce Developer at our company, you will be responsible for contributing to the design, development, customization, and maintenance of Salesforce applications. Your main role will involv...
VisualforceGitApexLightning Web Components LWCSOQLSOSLSalesforce configuration toolsSalesforce APIsSalesforce security modelSalesforce Developer ConsoleVS Code

Software Development Engineer - 2 (NextJS UI Developer)
RateGain Fresher Noida, Uttar Pradesh 23 Sep, 2025

As a highly skilled and experienced Full Stack Developer with expertise in Next.js and .NET, you will be joining our engineering team to design, develop, and deploy scalable applications. Your rol...
JavaScriptNETLINQTypeScriptReactNextjsASPNET CoreEntity Framework CoreTailwind CSSRedux ToolkitZustandReact QueryOAuth2OpenID ConnectJWTAzure AD

PREV
NEXT

aosp code base Job Openings

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers