cloud procurement jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

cloud procurement Job Openings

Showing 4601 - 4650 of 17478 Jobs

Gold Loan Officer

Scalong AI Fresher Noida, Uttar Pradesh 28 Sep, 2025

SaaS Developer

Best Infosystems Ltd Fresher Chennai 28 Sep, 2025

development testing

development

AI/ML Python (Data Scientist)

Best Infosystems Ltd Fresher Chennai 28 Sep, 2025

Analyst 2, Supply Chain Planning

Comcast Corporation Fresher Chennai, Tamil Nadu 28 Sep, 2025

Strong analytical skills

TMS

APICS

Attention to detail

Experience in purchase order PO management oversight

Familiarity with planning systems such as Anaplan

Proficiency in ERP tools including SAP

ARIBA

Admin Executive

Asian Paints Limited Fresher Chennai 28 Sep, 2025

Job Title:

Location:

Experience: purchase orderpurchasebillinginternational call centervendor managementmis reportingcustomer serviceprocurement negotiationprocurement executive

Java Backend developer
MNR Solutions Pvt Ltd Fresher Bangalore, NoidaNoida, Mumbai City 28 Sep, 2025

Dear Candidates, Currently looking for a Java Backend developer hiring for a Singapore based MNC On direct payroll Exp-5years NP-Immediate to 25th Aug before location-Noida, Mumbai Bangalore 5 ...
gcpapimicroservicesno sql

Opening for SAP ABAP- HANA in Bangalore location
HARJAI COMPUTERS PRIVATE LIMITED Fresher Bangalore 28 Sep, 2025

We are looking for an experienced SAP ABAP on HANA Consultant to join our team. The consultant will be responsible for custom development, enhancements, performance optimization, and technical su...
abapdatahanahcmsapfioriodata

MBA Professor
GoldenJobs Placement Solutions Pvt Ltd Fresher Ahmedabad, GandhinagarGandhinagar, Vadodara, Gandhidham, Jamnagar, Rajkot, Bhuj, Gir, Bharuch, Bhavn 28 Sep, 2025

Professor MBA / MCA Position: Professor Departments: MBA / MCA <...
lecturer activitiesmba lecturermca lecturerassitant professor

Marketo
LTIMindtree Limited Fresher Pune 25 Sep, 2025

Role Marketo Developer Skill Marketo KnowledgeHTMLCSSVelocity ScriptingBasic SQLRest API Knowledge Minimum Skill Requirements This exciting and interesting position will have the below respons...
Marketo

Opportunity for AWS Cloud Architect Role in Pune
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune 25 Sep, 2025

We are currently looking for an AWS Cloud Architect with 7 to 10 years of experience to join our team in Pune. Below are the key details of the role: Role: AWS Cloud Architect Experience: 7 to ...
awscloud

Senior Gen AI Engineer
Delta Sys-Tech (India) Pvt Ltd Fresher Hyderabad 25 Sep, 2025

Permanent job opening for Gen AI Engineer with US MNC organization at Hyderabad Required skills 5 years of professional experience in building Machine Learning models & systems...
machine learningartificial intelligencepythonlanggraphlangchainraggenerative ai

Adobe Analytics(dashboardSQL)
LTIMindtree Limited Fresher Hyderabad 25 Sep, 2025

An Adobe Support is a technical role responsible for Tier 1 Support using Adobe Experience Cloud products Their responsibilities typically span architecture solution design integration governanc...
Adobe Campaign

Technical Architect Associate
Chetu India Pvt Ltd Fresher Noida 25 Sep, 2025

Job Summary We are looking for a Technical Architect Associate who will assist in designing, developing, and implementing scalable technology solutions using AI/ML, Python, Java...
intelligencejavascriptpythonjava

Tender / GeM Executive IT Hardware & AMC- Delhi
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Delhi 25 Sep, 2025

Greeting! Job Title: Tender / GeM Executive IT Hardware & AMC Location: East of Kailash Experience Required: Minimum 3 years in the IT indust...
governmenthp iqe-marketplacegem

Senior Software Engineer 2
C3 India Delivery Centre LLP (formerly known as Crowe Horwath IT Services LLP) Fresher Noida, Uttar Pradesh 25 Sep, 2025

As a Senior Software Engineer II at C3 India Delivery Centre LLP, formerly known as Crowe Horwath IT Services LLP, you will be part of the Audit Transformation practice focusing on research, rapid...
RDBMSAzuremicroservicesAPIsPythonRustpresentation skillsMicrosoft technology stackNET frameworkfrontend developmentJavaScript frameworkNoSQL databasescloud platformserverlessAIML conceptsDevOps toolsAzure AI Foundry

Senior Software Development Engineer 2
SBS Fresher Noida, Uttar Pradesh 25 Sep, 2025

As an experienced professional with 6-8 years of experience, you will play a crucial role in the architectural design of the product, contributing your deep technical expertise. You will be respon...
JavaSpringSpring BatchMongoDBPostgreSQLRedisAngularCloud computingData structuresAlgorithmsDigital transformationAgile methodologiesMicroservices architectureReactive programmingEnterprisegrade components

SAP Work Manager Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

SAP WorkManager: Primary Skill: SAP Work Manager Delivery Role: Sr. Developer Experience Profile: 06-10 years Candidate should have good knowledge and working experience of SAP Agentry/Work M...
spmmobile developmentjavasap work managerworkdevelopermanager

Adobe Analytics(dashboardSQL)
LTIMindtree Limited Fresher Chennai 25 Sep, 2025

Job Description An Adobe Support is a technical role responsible for Tier 1 Support using Adobe Experience Cloud products Their responsibilities typically span architecture solu...
Adobe AnalyticsCampaign

Sales Development Representative
Live Connections Fresher Bangalore 25 Sep, 2025

KEY RESPONSIBILITIES: Identify/ Research prospects such as CIOs, IT directors from enterprise and government organization Make outbound calls to build early stage relationships and develop and...
businesssales developmentsales department processesgenerationcold callingdevelopmentinside sales

Sr. Data Engineer (Azure Synapse)
Versent Systems Ltd Fresher Ahmedabad, Gujarat 25 Sep, 2025

Role Overview: As a Senior Data Engineer with 5 to 8 years of experience and expertise in Azure Synapse and deep Azure data engineering, you will be responsible for designing and implementing data...
Data ArchitectsData engineeringAnalytical skillsAPIsDatabasesAzure DevOpsAzure SynapseAzure data engineeringData technologyData platform solutionsPresales ArchitectsCloud EngineersAzure data servicesProblemsolving skillsData pipelinesFile f

MERN Stack Developer
Arihant HR Consultancy Fresher Ahmedabad 25 Sep, 2025

Key Responsibilities

Develop and maintain end-to-end applications using MongoDB, Express.js, React.js, and Node.js.

Convert Figma/UI designs into responsive and interactive i...
restful apisawsnode.jsresponsive web designreact.jsexpress.js

Backend .NET Developer
AppleTech Fresher Vadodara, Gujarat 24 Sep, 2025

As a Web Application Developer at AppleTechSoft, you will be required to have a minimum of 5 years of hands-on experience in developing web applications on the Microsoft Windows Platform and cloud...
Software DesignArchitectureREST APIOODAOPSQL ServerSQL QueriesJOINSDatabase DesignLINQDebuggingAnalytical SkillsJAVASCRIPTDOJODockerMicrosoft TechnologiesVerbal CommunicationWritten CommunicationMicrosoft Windows PlatformCloud Technolog

Manufacturing Materials Procurement & Inventory Management Entry Professional
Hitachi Careers Fresher Vadodara, Gujarat 24 Sep, 2025

As a Factory Buyer at Hitachi Energy in Maneja-Vadodara, India, you will be an integral part of the Transformers Business Unit (BU) team. This team is dedicated to utilizing innovative technology ...
ProcurementSupply Chain ManagementVendor ManagementInventory ManagementCost OptimizationERPSAPLean ManufacturingKANBANVMIRisk EvaluationEngineering Drawing

Machine Learning Engineer
Sunflower Lab Fresher Vadodara, Gujarat 24 Sep, 2025

As a Machine Learning Engineer, you will be responsible for designing and implementing scalable machine learning models throughout the entire lifecycle - from data preprocessing to deployment. You...
PythonNumPySparkPandasScikitlearnTensorFlowPyTorchMLflowKubeflowDaskAWS SageMakerGCP AI PlatformWeightsBiasesDVCRay

Lead Engineer
SPENTO PAPERS (INDIA) LLP Fresher Udaipur, JaipurJaipur, Czech Republic, Ethiopia, Dominica, Agra, Dibrugarh, Varanasi, Kuwait, Rampur 24 Sep, 2025

Design Leadership & Management:

Lead and manage a team of engineers and designers within the [relevant discipline] to develop detailed designs for offsho...
offshore platformsoiloffshore oillifting operationsgaswell controllifting equipmentoffshore constructionunderbalanced drillingonshore operations

MERN Full Stack Developer
Xcellence-IT Fresher Surat, Gujarat 24 Sep, 2025

You will be joining a dynamic and forward-thinking IT solutions company, Xcellence-IT, as a MERN Full Stack Developer. In this role, you will be responsible for designing, developing, and maintain...
JavaScriptHTML5CSS3MongoDBRESTful APIsWeb servicesAWSAzureMochaMERN stackExpressjsReactjsNodejsVersion control systemsAgile development methodologiesTypeScriptGraphQLCICD

Senior React.js Developer
Inventam Tech Solution ( OPC ) Fresher Surat, Gujarat 24 Sep, 2025

As a Senior React.js Developer at our innovative IT services company specializing in cutting-edge software solutions, you will be at the forefront of developing an advanced finance and trading app...
JavaScriptHTML5CSS3WebSocketsAWSAzureReactjsTypeScriptReduxMobXContext APIMaterial UIAnt DesignNextjsD3js

Dy Manager - SCPC Buying
Mahindra Group Fresher Rajkot, Gujarat 24 Sep, 2025

You will be responsible for planning and procurement of parts for 4 platforms: LTV, MHCV, U202, W201, approximately 800 - 1000 parts per platform. Your role will involve coordinating with supplier...
Communication SkillsNegotiationRelationship ManagementConflict ManagementProcurementBenchmarkingCost ManagementCost Reduction ManagementMarket ResearchLogistics SystemsDigitizationAnalyticsSupplier DevelopmentSourcingInventory ManagementInf

Tech Lead
Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Role Overview: STL Digital is seeking a talented SAP CO Consultant to join their team in Bhadrak. As a SAP CO Consultant, you will be responsible for leading or supporting SAP FICO module integrat...
Internal OrdersProduct CostingVariance AnalysisCost SheetFunctional specificationsUnit testingIntegration testingProduction supportIssue resolutionSAP CO ConsultantCost Center Accounting CCAProfit Center Accounting PCAProfitability Analysis CO

.NET Developer
FinJo Fresher Khordha 24 Sep, 2025

You are an accomplished .NET Developer with over 4 years of professional experience, responsible for designing, developing, and maintaining enterprise web applications at client project sites. You...
SQL ServerOOPSOLID principlesJavaScriptjQueryHTML5CSS3AzureAWSGitAgile methodologyNET CoreNET FrameworkASPNET MVCWeb APIEntity FrameworkEF CoreRESTful services

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Administrative Executive
SHRI BALAJI ENTERPRISES Fresher Bhubaneswar, BaddiBaddi, Indore, Kolkata, Jamshedpur, Pune, Mumbai City, Vadodara, Ahmedabad, Guwaha 24 Sep, 2025

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill

General Manager - Logistics Operations
FTJ Consultants Fresher Ranchi, JamshedpurJamshedpur, Patna, Kanpur, Lucknow, Kolkata, Durgapur 24 Sep, 2025

General Manager - Logistics Operations Role & Responsibilities: - Handling general administration of the assigned area and accountable for monitoring the overall sales operatio...
material managementwarehouse operationsfreightsupply chainsupply planning

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Purchase & Store Executive
SEQRONICS (INDIA) PRIVATE LIMITED Fresher Mysore 24 Sep, 2025

Position:Purchase Executive / Procurement Officer Experience:Minimum1 years Education:Diploma/BE in Electricals & Electronics...
dispatch planningpurchase management

Assistant Purchasing Manager
Svenska Design Hotels Fresher Kakinada, Andhra Pradesh 24 Sep, 2025

The position of Purchase-cum-Stores Executive / Assistant Manager is available at APIIC Industrial Park, Ramanayyapeta, Kakinada 533005. The salary offered for this role ranges from 2.40 to 3.60 ...
PurchaseVendor CoordinationInventory Management

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Regional Sales Manager C&I Solar Projects
KGDC Enterprises LLP Fresher Jamshedpur, Jharkhand 24 Sep, 2025

As a Regional Sales Manager at KGDC Enterprises LLP, you will be responsible for leading the Commercial & Industrial (C&I) solar business across Eastern India. Your role will involve driving high-...
B2B salesRenewable EnergyElectrical EquipmentFeasibility studiesLeadership skillsSolar EPCIndustrial SolutionsCXO engagementSite surveys

Executive Chef
Tiffin Box Ranchi Fresher Ranchi, Jharkhand 24 Sep, 2025

The ideal candidate for this role is a seasoned chef who will be responsible for running an efficient kitchen. Your main tasks will include continually seeking ways to enhance the menu, ensuring t...
cheffinancial managementtrainingbudget constraintskitchen operations

Backe by DesignDgo Python Expert Senior Level
Inspire-I Solution Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Senior Python/Django Developer at our company based in Ahmedabad, India, you will be responsible for designing and building scalable backend solutions using Django, Python, and REST APIs. You...
PythonDjangoPostgreSQLMySQLOAuthGitDockerAWSGCPAzureRedisCeleryAngularREST APIsJWTCICD pipelinesReact

Key Accounts Manager ( Ahmedabad )
NITCO LIMITED Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Key Account Manager at NITCO, your role will involve managing the companys most strategic customer accounts in the tiles, marble, and mosaic segments. Your responsibilities will include build...
Relationship ManagementSales GrowthAccount PlanningStrategic Account IdentificationFinancial Controls

Civil Design Engineer
Delta Sys-Tech (India) Pvt Ltd Fresher Vadodara 24 Sep, 2025

Location:Vadodara, Gujarat Role: Civil Design Engineer Exp...
autocadsurveystadd procivil designroot mapsag tension calculationscivil erectionloading calculations

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Site Reliability Developer 4
Oracle Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Network Reliability Engineering (NRE) team at Oracle Cloud is responsible for ensuring the robustness of the Oracle Cloud Network Infrastructure. As a Network Reliability Engineer, your primar...
Network EngineeringMPLSBGPIPv6DNSDHCPSSLData Center designPythonScriptingAutomationNetwork monitoringNETCONFVxLANEVPNTelemetry solutionsYANG

PREV
NEXT

cloud procurement Job Openings

Professor MBA / MCA Position: Professor Departments: MBA / MCA <... lecturer activitiesmba lecturermca lecturerassitant professor

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ... communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Professor MBA / MCA Position: Professor Departments: MBA / MCA <...
lecturer activitiesmba lecturermca lecturerassitant professor

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill