modern architectures jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

modern architectures Job Openings

Showing 1651 - 1700 of 7954 Jobs

Capgemini is hiring for Datacom (L3/MPLS) Developer 3 to 8yrs - Chennai

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai 28 Sep, 2025

Were Hiring: Datacom (L3/MPLS) Developer

Location:

Experience:

Your Role: Datacom Developer L3/MPLS linux

React.js Developer
Simform Fresher Ahmedabad, Gujarat 28 Sep, 2025

As a skilled and passionate ReactJS Developer at Simform, you will be responsible for building and maintaining dynamic, high-performance web applications using ReactJS. Working closely with cross-...
JavaScriptHTML5CSS3SassRESTful APIsNPMGitSVNGithubBitbucketReactJSES6TypeScriptNodejsMixinsBabel

Senior Laravel Developer
Weisetech Developers Fresher Ahmedabad, Gujarat 28 Sep, 2025

Role Overview: As a skilled and motivated Web Developer with expertise in Laravel and WordPress, you will be joining the development team. Your role will involve working on high-load applications,...
LaravelWordPressPHPMySQLMariaDBHTMLCSSSassjQueryGitnpmAlpinejsTailwind CSS

MBA Professor
GoldenJobs Placement Solutions Pvt Ltd Fresher Ahmedabad, GandhinagarGandhinagar, Vadodara, Gandhidham, Jamnagar, Rajkot, Bhuj, Gir, Bharuch, Bhavn 28 Sep, 2025

Professor MBA / MCA Position: Professor Departments: MBA / MCA <...
lecturer activitiesmba lecturermca lecturerassitant professor

LEAD TECHNICAL CONSULTANT
HCL Technologies Fresher Nagpur, Maharashtra 25 Sep, 2025

The Full Stack Lead is responsible for leading the development and implementation of DevOps Solutions, React.js, and full stack java projects. You will oversee the entire software development life...
JenkinsDockerKubernetesDevOps SolutionsReactjs

Senior Gen AI Engineer
Delta Sys-Tech (India) Pvt Ltd Fresher Hyderabad 25 Sep, 2025

Permanent job opening for Gen AI Engineer with US MNC organization at Hyderabad Required skills 5 years of professional experience in building Machine Learning models & systems...
machine learningartificial intelligencepythonlanggraphlangchainraggenerative ai

Software Development Engineer 2
Advanced Micro Devices, Inc Fresher Hyderabad, Telangana 25 Sep, 2025

As a Software Development Engineer 2 at AMD, you will play a crucial role in driving and enhancing AMDs capabilities to deliver cutting-edge technologies to the market. You will be a key contribut...
PythonSoftware EngineeringAlgorithmsOperating SystemsLinuxEDA toolsScriptingData structure

Technical Architect Associate
Chetu India Pvt Ltd Fresher Noida 25 Sep, 2025

Job Summary We are looking for a Technical Architect Associate who will assist in designing, developing, and implementing scalable technology solutions using AI/ML, Python, Java...
intelligencejavascriptpythonjava

Senior Software Engineer 2
C3 India Delivery Centre LLP (formerly known as Crowe Horwath IT Services LLP) Fresher Noida, Uttar Pradesh 25 Sep, 2025

As a Senior Software Engineer II at C3 India Delivery Centre LLP, formerly known as Crowe Horwath IT Services LLP, you will be part of the Audit Transformation practice focusing on research, rapid...
RDBMSAzuremicroservicesAPIsPythonRustpresentation skillsMicrosoft technology stackNET frameworkfrontend developmentJavaScript frameworkNoSQL databasescloud platformserverlessAIML conceptsDevOps toolsAzure AI Foundry

Sr. Data Engineer (Azure Synapse)
Versent Systems Ltd Fresher Ahmedabad, Gujarat 25 Sep, 2025

Role Overview: As a Senior Data Engineer with 5 to 8 years of experience and expertise in Azure Synapse and deep Azure data engineering, you will be responsible for designing and implementing data...
Data ArchitectsData engineeringAnalytical skillsAPIsDatabasesAzure DevOpsAzure SynapseAzure data engineeringData technologyData platform solutionsPresales ArchitectsCloud EngineersAzure data servicesProblemsolving skillsData pipelinesFile f

Lead Quality Analyst
E2M Fresher Ahmedabad, Gujarat 25 Sep, 2025

Role Overview: As a proactive and experienced QA Lead, you will be responsible for overseeing and enhancing the quality assurance process for web development projects built on WordPress, Shopify, ...
Quality AssuranceWeb DevelopmentWordPressShopifyCMSManual TestingAutomation TestingTest CasesSOPsJIRATrelloTestRailMentoringAutomation ToolsGitQA LeadBigCommercePercyApplitoolsPlaywrightKatalon StudioEcommerce PlatformsGoHighLevel CR

Sales Distributor
Saathi Fresher Ahmedabad, Gujarat 25 Sep, 2025

As a Sales & Distribution personnel at Saathi, your role will involve developing and implementing sales & distribution plans for Saathi sanitary pads locally and internationally. You will be respo...
distributorsMicrosoft OfficedocumentationEnglishModern TradeGeneral tradeInternational salesStrategic thinkingCompetitive analysisAdobe Creative Suiteknowledge of consumer product channelsecommerce platformFMCG IndustryStrong writtenverbal c

Quality Assurance Automation Engineer (Mobile and Web)
Ventaja International Corp Fresher Vadodara, Gujarat 24 Sep, 2025

As a Senior QA Automation Engineer at Ventaja International Corp., you will play a crucial role in enhancing quality assurance practices across mobile and web platforms. Your primary responsibilit...
AppiumSeleniumTestNGJUnitPythonJavaJavaScriptJenkinsJMeterPostmanBrowserStackGitLab CI

Anesthesiologist
ETHOS HR MANAGEMENT AND PROJECTS PVT LTD Fresher Vadodara, Anand 24 Sep, 2025

Health Equity is a start-up which is now, one and half year old. Health Equitys mission is to take modern and professional healthcare to the last citizen in our villages. Health Equity is commit...
anesthesiologyanesthesia

React. JS Developer
Axone Infotech India Fresher Surat, Gujarat 24 Sep, 2025

As a React.js Developer with 1 to 5 years of experience, you will be a valuable member of our team responsible for developing and enhancing our modern web applications. Collaborating closely with ...
JavaScriptRESTful APIsSASSLESSGitReactjsReduxReact QueryCSS preprocessorsWebpack

HR Recruitment Manager - Manufacturing
YO IT CONSULTING Fresher Surat, Gujarat 24 Sep, 2025

As an HR Analyst located in Surat with 5 to 10 years of experience, you must have a background in recruitment, HR, or talent acquisition roles, with a specific focus on hiring for manufacturing or...
adaptabilitymanufacturingscreeningprocess designhuman resource developmentprocess improvementonboardingstakeholder managementhiringrecruitmentinterviewingmanagementdata analysissourcingtalent acquisitioncommunicationelectronicssourcing

.NET Developer
FinJo Fresher Khordha 24 Sep, 2025

You are an accomplished .NET Developer with over 4 years of professional experience, responsible for designing, developing, and maintaining enterprise web applications at client project sites. You...
SQL ServerOOPSOLID principlesJavaScriptjQueryHTML5CSS3AzureAWSGitAgile methodologyNET CoreNET FrameworkASPNET MVCWeb APIEntity FrameworkEF CoreRESTful services

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Executive Assistant
NARBHERAM MOTORS PRIVATE LIMITED Fresher Jamshedpur, Jharkhand 24 Sep, 2025

Role Overview: As an Executive Assistant at NARBHERAM MOTORS PRIVATE LIMITED in Jamshedpur, your primary responsibility will be to provide executive administrative support, handle expense reports,...
Executive Administrative AssistanceSchedulingVerbal CommunicationWritten CommunicationZoomExpense Reports ManagementOrganizational SkillsMicrosoft Office Suite

Senior Java Developer
Delta Sys-Tech (India) Pvt Ltd Fresher Ahmedabad 24 Sep, 2025

Permanent job opening for Java Fullstack Developer with US MNC organization at Ahmedabad Job Description Years of experience 6 9 / 9 - 12 years spring bootjavastackangularjshibernatemicroservicescore javareact.jsdeveloper

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Lead I - SE - React.Js, Typescript, Javascript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Front-End Developer with 7 years of experience, you will be responsible for developing modern, responsive, and high-performance web applications. Your primary focus will be on ...
JavascriptReactJsTypescript

React Developer
Navalt Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: As a React Developer, you will be responsible for creating, implementing, and maintaining high-quality user interfaces and application components. You should have at least 4 to 5 ye...
JavaScriptAPIsGitDebuggingTroubleshootingCommunication skillsReactjsReduxDOM manipulationReactjs workflowsData structure librariesAuthorization mechanismsFrontend building pipelines

Mobility Sales Lead
Reliance Jio Infocomm Limited Fresher Agra, Uttar Pradesh 24 Sep, 2025

As a Sales and Distribution professional, you will be responsible for achieving sales targets in both Urban and Rural territories. You will need to effectively manage various distribution channels...
Team management skillsCustomer focusTarget orientationKnowledge of channel salesKnowledge of productmarketProblem solving skillsNumerical

Chemist Assistant
JV Resume India Pvt Ltd Nagpur Fresher Nagpur, Maharashtra 23 Sep, 2025

You will be working as a Chemist Assistant in a Coal-based DRI sponge iron production plant located in Nagpur. Your role will involve conducting chemical analysis of raw materials, intermediate pr...
Strong analytical skillsProblemsolving skillsTeamwork skillsAttention to detailPrecision in chemistmodern testing techniquesGood communication abilitiesProficiency in using laboratory management systems

Software Development Engineer - 2 (NextJS UI Developer)
RateGain Fresher Noida, Uttar Pradesh 23 Sep, 2025

As a highly skilled and experienced Full Stack Developer with expertise in Next.js and .NET, you will be joining our engineering team to design, develop, and deploy scalable applications. Your rol...
JavaScriptNETLINQTypeScriptReactNextjsASPNET CoreEntity Framework CoreTailwind CSSRedux ToolkitZustandReact QueryOAuth2OpenID ConnectJWTAzure AD

Ui Developer
Best Infosystems Ltd Fresher Chennai 23 Sep, 2025

UI Developer_Full-time_Chennai Job Tittle: UI Developer Job Type: Full-time Location: Chennai Experience Level: Experience: 4-9 years (1 SE and 1 SSE) Shift Timing: 11 AM 8 PM Job Decription: ...
development

Software Developer 3 (Java fullstack)
Oracle Fresher Ahmedabad, Gujarat 23 Sep, 2025

Oracle Health Data Intelligence is seeking a Senior Software Engineer to join the HealtheCare Care Coordination team. In this role, you will write and configure code based on technical specificati...
JavaRubyHadoopMapReduceSparkETLSQLJenkinsKubernetesOCIAWSAzureDevOpsAgile methodologiesCucumberSeleniumCrunchRESTful servicesHadoop Ecosystem

Cnc Operator
Integrated Personnel Services Limited Fresher Kolkata, GurugramGurugram, Mumbai City, Bangalore, Chennai, Noida, Hyderabad, Pune, Delhi 20 Sep, 2025

Job Title: Conventional Lathe Operator - Millers or Turners Location: Germany Experience: 3 to 5 years Job Overview: We are seeking a skilled ...
cnc machinelathe machinecnc millingcnc turner

Software Engineer, Networking
SHRI BALAJI ENTERPRISES Fresher Kolkata, Mumbai CityMumbai City, Bangalore, Chennai, Indore, Hyderabad, Pune 20 Sep, 2025

We are seeking aPython Engineerwithstrong experience in AWS cloud servicesto join our engineering team. You will design, develop, and deploy scalable back-end sy...
softwaremaintenancetestingnetworkingmainframedevelopmentapplication

ReactJS Developer
Redspark Technologies LLP Fresher Vadodara, Gujarat 20 Sep, 2025

As a ReactJS Developer with 2 to 3 years of experience, you will be responsible for developing and maintaining responsive web applications using React.js. Your key responsibilities will include: ...
JavaScriptHTML5CSS3RESTful APIsNPMYarnGitReactJSReduxContext APIZustandReact HooksGraphQLWebpackBabelJest

Node Js Developer
3Elixir Solutions Fresher Surat, Gujarat 20 Sep, 2025

As a NodeJS developer, you will be responsible for leveraging your programming skills and in-depth knowledge of modern technologies such as HTML, CSS, JavaScript, NodeJS, and related frameworks to...
JavascriptExpressRest APINodeJsBebal

Junior Full Stack Ruby Developer
Avinyaa Ed Tech Private Limited Fresher Surat, Gujarat 20 Sep, 2025

As a Junior Full Stack Ruby Developer at Avinyaa EdTech, you will be part of an innovative and rapidly growing EdTech company dedicated to revolutionizing the educational experience through cuttin...
RubyRuby on RailsJavaScriptHTML5CSS3RESTful APIsMySQLPostgreSQLMongoDBGitDockerAWSGCPJiraTrelloTDDReactjsVuejsGraphQLAgile development methodologies

Senior WordPress Developer
Tretanz Infotech Fresher Rajkot, Gujarat 20 Sep, 2025

You are an experienced Senior WordPress Developer with a minimum of 3 years of hands-on experience, seeking a full-time, on-site position at Tretanz Infotech in Rajkot. Your main responsibility wi...
PHPHTMLCSSJavaScriptjQueryMySQLGitWordPress developmentBackend web developmentFullstack web developmentObjectOriented Programming OOP

Front End Developer/Designer
Empyreal Infotech PVT LTD Fresher Rajkot, Gujarat 20 Sep, 2025

We are seeking a skilled Front-End Developer/Designer to become a valuable part of our team. The perfect candidate will possess a solid grasp of contemporary front-end development, UI/UX design pr...
HTMLCSSJavaScriptSASSLESSGitGitHubGitLabRESTful APIsFrontend frameworksUIUX designFigmaAdobe XD

Montessori Teacher
KMK HrSec & Montessori School Fresher Karaikal 20 Sep, 2025

The Senior Montessori Teacher & Team Lead position at KMK Higher Secondary & Montessori School in Karaikal is a full-time role requiring a minimum of 3 years of experience in a Montessori environm...
mentoringtraininglesson planningcommunicationleadershipinterpersonal skillschild developmentMontessori methodologyguidingclassroom setup

Area Sales Manager for consumer durable
Talent Leads HR Solutions Pvt Ltd Fresher Nagpur, Pune 20 Sep, 2025

Job Responsibilities:

Handling key accounts Consumer Durable and Consumer Electronics distribution.

Distribution handling (Primary Sales /...
salesdistributor salesdealer

.NET Developer
Zine Mind Fresher Kochi, Kerala 20 Sep, 2025

As a suitable candidate for the position, you should possess 5-12 years of experience in software development using .NET Core / ASP .NET with C# & SQL Server. Your hands-on experience in MVC and D...
ASP NETSQL ServerMVCAzureWCF servicesEntity FrameworkWeb ServicesHTMLXMLOOADesign patternsNET CoreDatabase conceptsNtier architecturesDynamic contentSecurity modelsCloud knowledgeWeb APIOOD Concepts

Senior Software Engineer
Fingent Fresher Kochi, Kerala 20 Sep, 2025

You will be a Senior Software Engineer in the .NET domain at Fingent, where we believe in leveraging technology to create a positive impact on the lives of people. Our software solutions are desig...
jQueryEntity FrameworkLINQSQL AzureAppFabricCNETASPNET MVC FrameworkNet CoreAngular 2OOPS conceptsWeb API

Branding Expert
Lavishtag Fresher Rourkela 20 Sep, 2025

Lavishtag is a fast-fashion jewellery brand committed to delivering trendy and high-quality 925 silver jewellery that resonates with personal style and modern fashion. Our designs reflect elegance...
Brand DevelopmentBrand ManagementDigital MarketingSocial MediaContent StrategyCommunication SkillsProject ManagementLeadership SkillsProblem SolvingPR StrategyMedia Relationship BuildingCreative ThinkingFashion Sector KnowledgeJewellery Secto

Senior Software Engineer (ReactJS)
Best Infosystems Ltd Fresher Gurugram 20 Sep, 2025

Senior Software Engineer (ReactJS)_Full-Time_Gurugram & Bangalore Hi, Greetings from Best Infosystems Ltd.! Weve spotted your impressive profile and have an exciting opportunity tailored to your...
react.jsengineeringsoftwareseniorreactjs

Senior Machine Learning Engineer - 2 (Architect)
Adobe Fresher Noida, Uttar Pradesh 20 Sep, 2025

The Adobe Express team is on a mission to create a revolutionary, all-in-one creative application that transcends platforms - be it web, desktop, or mobile. By blending Adobes cutting-edge creativ...
PythonComputer VisionNLPMachine LearningDeep LearningTensorFlowPyTorch

.NET Developer - Team Leader
Webito Infotech Fresher Ahmedabad, Gujarat 20 Sep, 2025

You will be joining Webito Infotech, a team of enthusiastic technologists dedicated to providing innovative solutions. Our focus is on creating exceptional web and app experiences that align with ...
jQuerySQLSQL ServerMicroservicesElasticsearchKafkaStrong communication skillsTeam leadingClient handlingNET MVCwriting stored proceduresNET FrameworkCoreAngular 2AzureAWS Cloud ServicesData StructuresAlgorithmsMongoDBCosmos DBRedisMemcache

Senior Python & Spark Developer
Best Infosystems Ltd Fresher Mumbai City, Ahmedabad 16 Sep, 2025

Senior Python & Spark Developer_full-time_Ahmedabad & Mumbai Job Title: Senior Python & Spark Developer Experience Required: 5 years Location: Ahmedabad preferred, but open for Mumbai Role Over...
pythondjangoflaskseniorapachesparkjenkins dockerdeveloper

Junior Software Developer
ADCC Academy Fresher Nagpur, Maharashtra 15 Sep, 2025

You will be working under the guidance of a Senior Software Developer and collaborating with the team to analyze requirements, design software architecture, and develop high-quality, scalable code...
JavascriptHTMLCSSJQueryAngularJSAngularSQL ServerJoinsNET programming languagesServer technologiesarchitecturesWeb TechnologiesLanguagesWorkflow DevelopmentMicrosoft Development Toolsfrontend technologiesdatabase like oracleLocalizationGlob

Silicon Design Engineer 2
AMD Fresher Hyderabad, Telangana 15 Sep, 2025

As a Silicon Design Engineer 2 at AMD, your role involves collaborating with formal experts and designers to verify formal properties and drive convergence. You will have the opportunity to work o...
Processor ArchitectureDigital DesignVerificationRTL DesignSystemVerilogUVMFormal VerificationClock GatingComputer ArchitectureSilicon Design

PREV
NEXT

modern architectures Job Openings

Professor MBA / MCA Position: Professor Departments: MBA / MCA <... lecturer activitiesmba lecturermca lecturerassitant professor

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Professor MBA / MCA Position: Professor Departments: MBA / MCA <...
lecturer activitiesmba lecturermca lecturerassitant professor