cloud computing background jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

cloud computing background Job Openings

Showing 6051 - 6100 of 23163 Jobs

.NET Developer

FinJo Fresher Khordha 24 Sep, 2025

NET CoreNET Framework

ASPNET MVC

Web API

Entity FrameworkEF Core

RESTful services

presales consultant

BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.
Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Apply for For life insurance Salary 7Lac APC Sales

Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Ranchi, JamshedpurJamshedpur, Patna, Bhubaneswar, Howrah, Hooghly, Kolkata, Faridabad, Delhi, Guwaha 24 Sep, 2025

Kotak Life Insurance

Location

Salary life insuranceagency salessalessales manageragency development managerterritory sales managerrelationship officerdeputy branch managerbusiness development manager

Development Manager For Direct Sales Life Insurance
Niyukti Management Consultants Fresher Patna, KolkataKolkata, Bhubaneswar, Noida, Ghaziabad, Lucknow, Gurugram, Faridabad, Chandigarh, Delh 24 Sep, 2025

Area Manager For Direct Sales

To generate The Business Through Direct Sales.

Comp. Gives you LeadFor Direct Channel.

Salar...
direct marketinglife insurancesalesdirect channel salessales development managerrelationship managerassistant sales managerrelationship officerunit manager

Development Manager For Direct Sales Life Insurance
Niyukti Management Consultants Fresher Patna, KolkataKolkata, Bhubaneswar, Noida, Ghaziabad, Lucknow, Gurugram, Faridabad, Chandigarh, Delh 24 Sep, 2025

Area Manager For Direct Sales

To generate The Business Through Direct Sales.

Comp. Gives you LeadFor Direct Channel.

Salar...
direct marketinglife insurancesalesdirect channel salessales development managerrelationship managerassistant sales managerrelationship officerunit manager

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Inside Sales Manager
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Mysore, ChennaiChennai, Bangalore, Madurai 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Virtual Data Entry Clerk Office Operations
Divine HR Services Fresher Mysore, ChennaiChennai, Bangalore, Howrah, Tamil Nadu, Indore, Gangtok, Mumbai City, Port Blair, Coi 24 Sep, 2025

Dear Candidate, Well provide you Typing, SMS Sending, Ads Posting etc. online works which you can do by mobile orPosition Available: Fresher / Back Office / Computer Operator / Data Entry Opera...
data entryback officepart timeback office operationsenglish writingcomputer operating

Senior Telesales Executive
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Madurai, ChennaiChennai, Bangalore, Mysore 24 Sep, 2025

Job Title: Senior Telesales Executive

Position Overview We are seeking a dynamic and results-driven Senior Telesales Executive to join our growing team. This role is pivotal in driv...
software marketingsoftware salestelesalestelemarketingtelecom salestelecalling

Inside Sales Manager
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Madurai, ChennaiChennai, Bangalore, Mysore 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Sales Managing Partner Health Insurance Salary 5.5Lac
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Ludhiana, ChandigarhChandigarh, Delhi, Bareilly, Firozabad, Noida, Ghaziabad, Lucknow, Gurugram, Far 24 Sep, 2025

Managing Partner APC Sales Life Insurance,. Location chandigarh,Faridabad,Lucknow,Varanasi ,Kanpur, Ghaziabad,Delhi,Noida,Faridabad,Kolkata Salary- 5.5 lac Rimb Incentive Exp.4 To 14 sales J...
life insurancehealthinsuranceagency channelunit sales managerrelationship managersales managerterritory sales managersr.agency manager

Sales Managing Partner Health Insurance Salary 5.5Lac
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Ludhiana, ChandigarhChandigarh, Delhi, Bareilly, Firozabad, Noida, Ghaziabad, Lucknow, Gurugram, Far 24 Sep, 2025

Managing Partner APC Sales Life Insurance,. Location chandigarh,Faridabad,Lucknow,Varanasi ,Kanpur, Ghaziabad,Delhi,Noida,Faridabad,Kolkata Salary- 5.5 lac Rimb Incentive Exp.4 To 14 sales J...
life insurancehealthinsuranceagency channelunit sales managerrelationship managersales managerterritory sales managersr.agency manager

Business Development Manager
Niyukti Management Consultants Hiring For Niyukti Fresher Ludhiana, Chandigarh 24 Sep, 2025

Job Summary:
We are looking for a results-driven and motivated Business...
insurancearea salesagency salesbusiness developmentlife insurance

Public Relations Officer
Divine Heart & Multispeciality Hospital Fresher Lucknow, Uttar Pradesh 24 Sep, 2025

Role Overview: You are currently seeking a dynamic and experienced Public Relations Officer (PRO) with a background in the hospital industry to join the team at Divine Heart & Multispeciality Hosp...
Public RelationsMedia RelationsCommunicationInterpersonal SkillsCrisis CommunicationStrategic Planning

Hiring Deputy Area Manager (IMF Channel | Life Insurance)
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Lucknow, KanpurKanpur, Varanasi, Noida, Delhi, Ghaziabad, Bhubaneswar, Kolkata, Gurugram, Faridabad 24 Sep, 2025

Were Hiring Deputy Area Manager (IMF Channel | Life Insurance) Industry: Life Insurance life insuranceagency managerassistant branch managersr.sales managerchief business managerunit sales managersales executiveassociates partner sourcingdistribution manager

Business Development role salary structure for 5 LPA (5 Lakh Per Annum)
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Lucknow, VaranasiVaranasi, Bareilly, Sitapur, Basti, Barabanki, Moradabad, Gurugram, Kolkata, Farida 24 Sep, 2025

Job Title: Agency Development Manager Business Development Company: Leading Life Insurance Company ...
life insurancedevelopmentsalesbusinessbusiness development managerrelationship managersr.sales manageragency development managerarea sales managersr.relationship manager

Sales Managing Partner Health Insurance Salary 5.5Lac
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Lucknow, NoidaNoida, Delhi, Bareilly, Firozabad, Ghaziabad, Gurugram, Faridabad, Ludhiana, Chandigar 24 Sep, 2025

Managing Partner APC Sales Life Insurance,. Location chandigarh,Faridabad,Lucknow,Varanasi ,Kanpur, Ghaziabad,Delhi,Noida,Faridabad,Kolkata Salary- 5.5 lac Rimb Incentive Exp.4 To 14 sales J...
life insurancehealthinsuranceagency channelunit sales managerrelationship managersales managerterritory sales managersr.agency manager

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Customer Service Representative pharma
Confidential Fresher Jodhpur, Rajasthan 24 Sep, 2025

As a CSR- Customer Service Representative, you will be responsible for providing correct and effective communication to existing and prospective customers regarding products and their applications...
Self motivatedGood Communication SkillsCore Selling SkillsGood Customer Relationship Management SkillsBasic internet skillsReady to work in Operating Theatre environmentExposure to healthcare business

Apply for For life insurance Salary 7Lac APC Sales
Niyukti Management Consultants Hiring For Niyukti Management Consultants Fresher Jamshedpur, RanchiRanchi, Patna, Bhubaneswar, Howrah, Hooghly, Kolkata, Faridabad, Delhi, Guwahati 24 Sep, 2025

Kotak Life Insurance Sr.Managing Partner (APC) LocationDelhi, Faridabad,Kolkata,Hoogly, Guwahati,Howrah,Patna,Bhubneshwer,Ranchi,Jamshedpur Salary life insuranceagency salessalessales manageragency development managerterritory sales managerrelationship officerdeputy branch managerbusiness development manager

Executive Chef
Tiffin Box Ranchi Fresher Ranchi, Jharkhand 24 Sep, 2025

The ideal candidate for this role is a seasoned chef who will be responsible for running an efficient kitchen. Your main tasks will include continually seeking ways to enhance the menu, ensuring t...
cheffinancial managementtrainingbudget constraintskitchen operations

Billing Assistant
Blue Wing Talent Management Fresher Giridih, Jharkhand 24 Sep, 2025

You are looking for a Billing Executive with 3 to 5 years of experience, strong Tally & Excel skills, and a background in warehouse or logistics industries. The position is based in Giridih and ac...
Tally ERPMS ExcelBillingAccounts

Area Sales Manager (ASM)
SFC Inframate Pvt Limited Fresher Ranchi, Jharkhand 24 Sep, 2025

As an Area Sales Manager in the construction and building materials industry, you will be responsible for overseeing sales activities within a designated geographic area. Your primary focus will b...
SalesLeadershipCommunicationConstruction

STP Operators
Tiara Consultancy Services Fresher Bokaro, Chandrapur 24 Sep, 2025

** Job Opening: STP Operators (3 Shifts 2 Positions)** **Company:** Tiara Consultancy **Locations:** **Chandrapur** & **Bokaro** **Industry:** Water Treatment / Thermal Power Plants ** Job Role:...
operationsdiplomamechanicalmaintenancesewagestpwaterciviltreatmentoperatorplantengineer

Service Engineer
CONCEPTS GLOBAL Fresher Jaipur, BangaloreBangalore, Mumbai City, Vadodara 24 Sep, 2025

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation

Field Sales Executive ( Relationship Manager)
SAPIENCE STAFFING & SERVICES PVT LTD Fresher Jaipur, DelhiDelhi, Ghaziabad, Gurugram 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Field Sales Executive (Relationship Manager) to join our team. This role is pivotal in driving our business grow...
business loansecured financingbusiness loansmortgage loanmortgage loanslaphousing loanhousing finance

Plant Head
FTJ Consultants Fresher Gwalior, IndoreIndore, Jaipur, Delhi, Haridwar 24 Sep, 2025

Job description

Drive and Manage for Plant Performance with defined Objectives for Customer satisfaction.

Identify and manage the list of areas across the pl...
sheet metal componentsprofitabilitymanufacturing operationsplant operationsmanpower planning

Machine Operator/Labourer
Zenium Cables Pvt Ltd Fresher Vapi, Gujarat 24 Sep, 2025

You are invited to join Zenium Cables Limited as a Machine Operator for various machines including Extruder, Stranding, Laying, and Armour machines. We have openings for 2 posts each for Extruder ...
Cable Manufacturing Experience

Product Manager - Pharma PMT
9 Planets Placements Fresher Ahmedabad, Gujarat 24 Sep, 2025

You will be joining a dynamic team at 9 Planets Placements as a Product Manager - Pharma PMT based in Ahmedabad. In this full-time role, your primary responsibilities will include overseeing produ...
Product ManagementProduct DevelopmentMarket ResearchStrategic PlanningBusiness AnalysisRevenue GenerationMarketing StrategyCampaign ManagementRegulatory ComplianceCommunication SkillsPeople Management

Backe by DesignDgo Python Expert Senior Level
Inspire-I Solution Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Senior Python/Django Developer at our company based in Ahmedabad, India, you will be responsible for designing and building scalable backend solutions using Django, Python, and REST APIs. You...
PythonDjangoPostgreSQLMySQLOAuthGitDockerAWSGCPAzureRedisCeleryAngularREST APIsJWTCICD pipelinesReact

Team Lead- EXIM
AP Moller - Maersk Fresher Halol, Gujarat 24 Sep, 2025

As an Export Shipment Manager at Maersk Area Office, your role is crucial in delivering on the SCM Strategy within the specified geographical area. You will be responsible for managing End-to-End ...
MS Excel

sales manager- Building material
Glan Management Consultancy Fresher Ahmedabad, IndoreIndore, Noida, Pune 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Sales Manager specializing in Building Materials to join our team. This role is pivotal in driv...
business developmentwall panelsplywoodlaminate flooringbuilding material

QC Manager- Building material (Wall panel, tiles, glass)
Glan Management Consultancy Fresher Ahmedabad 24 Sep, 2025

Position Overview We are seeking a dedicated and experienced QC Manager specializing in building materials, including wall panels, tiles, and glass, to join our dynamic team ...
six sigmabuilding materialqc inspectionqc tools

Senior Data Scientist
aloola Fresher Surat, Gujarat 24 Sep, 2025

We are looking for an experienced Senior Data Scientist to join our team at Aloola Solutions. As a Senior Data Scientist, you will be responsible for leveraging advanced analytics, machine learnin...
PythonR ProgrammingHadoopSparkTableauPower BISQLData ModelingMachine Learning AlgorithmsBig Data Technologies

Chief Executive Officer
Dhruv Corporate (HR) Solutions Pvt Ltd Fresher Ahmedabad, Gujarat 24 Sep, 2025

As the Chief Executive Officer (CEO) at the leading manufacturing company in Tanzania, specializing in a wide range of products including cement and raffia bags, flexible packaging, garments, agri...
Manufacturing processesQuality standardsProduction planningResource allocationQuality assuranceTeam managementStakeholder engagementBudgetingFinancial managementRegulatory complianceLeadershipIndustry trendsEfficiency improvementTechnical inn

Assistant Manager FMCG Company
sk online services Fresher Ahmedabad, Andhra PradeshAndhra Pradesh, Gujarat, Baddi, Bangalore, Kullu, Dharamshala, Dalhousie, B 24 Sep, 2025

Job description In case of any query, kindly connect on78,34,98,21,39 Rita Preference will be given to immediate joiners. We are looking for a skilled Assistant Manager t...
management skillsproduct trainingproject planningcustomer serviceinventoryteam leadingcommunication skillsproduct qualityleadership

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Site Reliability Developer 4
Oracle Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Network Reliability Engineering (NRE) team at Oracle Cloud is responsible for ensuring the robustness of the Oracle Cloud Network Infrastructure. As a Network Reliability Engineer, your primar...
Network EngineeringMPLSBGPIPv6DNSDHCPSSLData Center designPythonScriptingAutomationNetwork monitoringNETCONFVxLANEVPNTelemetry solutionsYANG

Python / Gen AI Developer
LION AND ELEPHANTS CONSULTANCY PRIVATE LIMITED Fresher Erode, CoimbatoreCoimbatore, Chennai, Tambaram, Pudukottai, Dindigul, Namakkal, Kumbakonam, Bangalor 24 Sep, 2025

Job Overview: We are looking for an experienced and passionate Python/Gen AI Developer to join our team in Coimbatore. The ideal candidate will have strong expe...
pythoncloud awsartificial intelligencedjangoflaskllmsgenerative ailanggraphpyspark

Virtual Data Entry Clerk Operations
Divine HR Services Fresher Coimbatore, ChennaiChennai, Bangalore, Tamil Nadu, Odisha, Vishakhapatnam, Kolkata, Pune, Mangalore, 24 Sep, 2025

Dear Candidate, Providing Part time full time home based jobs to all candidates who are willing to work for 2 to 3 hours Position Fresher Computer Operator Data Entry Operator Fresher / Back Of...
data entryback officepart timeback office operationsenglish writingcomputer operating

Development Manager For Direct Sales Life Insurance
Niyukti Management Consultants Fresher Chandigarh, BhubaneswarBhubaneswar, Noida, Ghaziabad, Lucknow, Gurugram, Kolkata, Faridabad, Delhi, 24 Sep, 2025

Area Manager For Direct Sales

To generate The Business Through Direct Sales.

Comp. Gives you LeadFor Direct Channel.

Salar...
direct marketinglife insurancesalesdirect channel salessales development managerrelationship managerassistant sales managerrelationship officerunit manager

BDM Inventory Planning
SpareCare Inventory Solutions LLP Fresher Bhopal, BhubaneswarBhubaneswar, Kolkata, Delhi 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Business Development Manager (BDM) in Inventory Planning to join our team. This role is pivotal in optimizing ou...
supply chain managementpresentation skillsms excelparts orderingspare partsdemand forecastingbusiness analyticscommunication skills

Academic Head
Geeks of Gurukul Fresher Bhopal, Madhya Pradesh 24 Sep, 2025

As a valuable member of our team, you will collaborate with faculty members to enhance and modernize the curriculum in alignment with industry demands. Your primary responsibility will be to ensur...
Team management

PREV
NEXT

cloud computing background Job Openings

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m... market researchsales strategysales promotionsales administrationsalesmarketing

Job Title: Senior Telesales Executive

Position Overview We are seeking a dynamic and results-driven Senior Telesales Executive to join our growing team. This role is pivotal in driv... software marketingsoftware salestelesalestelemarketingtelecom salestelecalling

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m... market researchsales strategysales promotionsales administrationsalesmarketing

Job Summary:

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron... electronicslaminationphotocopiershreddersinstallation

Position Overview We are seeking a dynamic and results-driven Field Sales Executive (Relationship Manager) to join our team. This role is pivotal in driving our business grow... business loansecured financingbusiness loansmortgage loanmortgage loanslaphousing loanhousing finance

Position Overview We are seeking a dynamic and results-driven Sales Manager specializing in Building Materials to join our team. This role is pivotal in driv... business developmentwall panelsplywoodlaminate flooringbuilding material

Position Overview We are seeking a dedicated and experienced QC Manager specializing in building materials, including wall panels, tiles, and glass, to join our dynamic team ... six sigmabuilding materialqc inspectionqc tools

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Position Overview We are seeking a dynamic and results-driven Senior Telesales Executive to join our growing team. This role is pivotal in driv...
software marketingsoftware salestelesalestelemarketingtelecom salestelecalling

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Position Overview We are seeking a dedicated and skilled Service Engineer to join our dynamic team. This role is essential in ensuring the optimal performance of our electron...
electronicslaminationphotocopiershreddersinstallation

Position Overview We are seeking a dynamic and results-driven Field Sales Executive (Relationship Manager) to join our team. This role is pivotal in driving our business grow...
business loansecured financingbusiness loansmortgage loanmortgage loanslaphousing loanhousing finance

Position Overview We are seeking a dynamic and results-driven Sales Manager specializing in Building Materials to join our team. This role is pivotal in driv...
business developmentwall panelsplywoodlaminate flooringbuilding material

Position Overview We are seeking a dedicated and experienced QC Manager specializing in building materials, including wall panels, tiles, and glass, to join our dynamic team ...
six sigmabuilding materialqc inspectionqc tools