deal with vendors jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

deal with vendors Job Openings

Showing 1901 - 1950 of 10451 Jobs

Business Development Manager- SAAS Sales

BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Hyderabad, BhubaneswarBhubaneswar, Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, 01 Oct, 2025

Business Development Manager- SAAS Sales

Experience:3 -15 Years

Salary - 6 LPA -12 LPA

Minimum- 3 Years Experience

...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

ITIL Process Analyst / ITIL Support in Pune and Hyderabad for Top IT Companies
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Hyderabad 01 Oct, 2025

We are hiring an experienced ITIL Process Analyst / Support Profe...
incident managementcabchange managementservicenowproblem managementitsmbmc remedyslaitil v4

Financial Analyst- Project Finance
GALLAGHER AND MOHAN PRIVATE LIMITED Fresher Hyderabad, BangaloreBangalore, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi 01 Oct, 2025

Job Opportunity: Financial Analyst - Project Finance Company Overview: Gallagher & Mohan is a distinguished firm specializing in delivering wor...
dcf valuationfinancial modellingrenewable energyvaluation modeling

Sales Manager - Real estate
Moneytree Realty Services Limited Fresher Gurugram, Noida 01 Oct, 2025

Job Title: Sales Manager Real Estate Location: (Sector 63, Sector 126) Noida Company: Money Tree Realty Services Limited Employment Type: Full-time About the Role We are looking for an experien...
team managementchannel partner managementresidential salesreal estate salesbusiness developmentcommercial salesclient acquisitionteam handling

Sales Manager - Real estate
Moneytree Realty Services Limited Fresher Noida, Gurugram 01 Oct, 2025

Job Title: Sales Manager Real Estate Location: (Sector 63, Sector 126) Noida Company: Money Tree Realty Services Limited Employment Type: Full-time About the Role We are looking for an experien...
team managementchannel partner managementresidential salesreal estate salesbusiness developmentcommercial salesclient acquisitionteam handling

Assistant Area Manager
Kapil Consultancy Recruitment Services Pvt Ltd Fresher Chandigarh, ChennaiChennai, Tiruchirappalli, Udaipur, Mumbai City, Meerut, Durgapur 01 Oct, 2025

Company- Aditya Birla Money Position- Assistant Area manager Years of exp- 4 Ctc- upto 7 LPA NP - imm to upto 2 months Age- max upto 32 years of age Locations- Chennai,Trichy, udaipur, chandigarh...
mutual fundsbankinglife insurancesalesinsuranceagency developmentrelationship managementhni acquisitionagency saleswealth

Executive Contract
ilios digital Fresher Chennai, Tamil Nadu 01 Oct, 2025

Role Overview: At Iliosdigital, we are looking for a highly motivated Fresher to join our Bidding and Procurement Team as an Executive Contracts. You will be responsible for assisting in preparing...
Interpersonal skillsGood communication skillsStrong attention to detailOrganizational skillsBasic understanding of procurementtendering processesProficient in Microsoft Office toolsAnalytical mindsetProblemsolving abilityWillingness to learn

Business Development Manager- SAAS Sales
BRIGHT IT GLOBAL SOLUTIONS PRIVATE LIMITED Hiring For BDM Fresher Chennai, BhubaneswarBhubaneswar, Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, 01 Oct, 2025

Business Development Manager- SAAS Sales Experience:3 -15 Years Salary - 6 LPA -12 LPA Minimum- 3 Years Experience ...
b2b salesbusiness excellencecorporate salespresaleslead generationsales

Materials Manager
Pneumatic Vacuum Elevators and Lifts-India Private Limited Fresher Chennai 01 Oct, 2025

Job Title: Materials Manager Location: Guduvanchery Employment Type: Full-time Job Summary The Materials Manager is respons...
material managementfifomaterial procurementmaterial planning

Assistant Area Manager
Kapil Consultancy Recruitment Services Pvt Ltd Fresher Chennai, TiruchirappalliTiruchirappalli, Udaipur, Chandigarh, Mumbai City, Meerut, Durgapur 01 Oct, 2025

Company- Aditya Birla Money Position- Assistant Area manager Years of exp- 4 Ctc- upto 7 LPA NP - imm to upto 2 months Age- max upto 32 years of age Locations- Chennai,Trichy, udaipur, chandigarh...
mutual fundsbankinglife insurancesalesinsuranceagency developmentrelationship managementhni acquisitionagency saleswealth

Senior Network Engineer
Ishan Technologies Fresher Ahmedabad, Gujarat 01 Oct, 2025

As a Senior Network Engineer at our company, you will play a crucial role in designing, implementing, maintaining, and troubleshooting our complex network infrastructure. Your deep expertise in ne...
TCPIPRouting ProtocolsQoSFirewallsVPN ConfigurationNetwork TroubleshootingScripting LanguagesAutomation ToolsAnalytical SkillsSwitching ProtocolsNetwork Security TechnologiesLoad Balancing SolutionsLinuxUnix Operating SystemsVerbalWritten Co

Mechanical Production supervisor
Khodiyar Engineers Fresher Ahmedabad, Gujarat 01 Oct, 2025

As a Mechanical Engineer at our company based in Ahmedabad, Gujarat, you will be responsible for the following tasks: - Delivery of orders within specified timelines - Arranging short materials r...
manpower managementknowledge of MSOffice

Lead Generation Specialist
Morpheus Human Consulting Pvt Ltd Fresher Pune, BangaloreBangalore, Noida, Chennai, Hyderabad, Kolkata, Mumbai City, Delhi 28 Sep, 2025

Reference Code: MHC-2025-05

Job Title: Business Acquisition Manager - Mumbai

Job Summary:

To contrib...
lead generationcold callingcorporate sales

Manufacturing Technician Toolmaker
Taggd Fresher Pune 28 Sep, 2025

Manufacturing Technician Toolmaker

Must be self-motivated and able to take ownership of the appointed task to follow through to completion with little supervision. technician activitiesdrillingcaliperspneumaticslathemillingmanufacturinghydraulicscnc maintenancetoolmaker

SailPoint IIQ Senior Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Hyderabad, BangaloreBangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

As a Senior Sailpoint Developer, you will be tasked with analyse, design and support implementation of business- specific Sailpoint solutions and/or framework. In addition, as Sailpoint developer...
devopssailpointsql

Senior Software Developer (FullStack)
Best Infosystems Ltd Fresher Gurugram 28 Sep, 2025

Job Title: Senior Software Developer (FullStack) Experience Required: 4 years Location: Gurugram Note: Candidate should be good in front-end development. Passport Mandatory. KEY ACCOUNTABILITIE...
software developmentsoftware

Analyst 2, Supply Chain Planning
Comcast Corporation Fresher Chennai, Tamil Nadu 28 Sep, 2025

Job Description Role Overview: As a Supply Chain Coordinator at Comcast, you will be responsible for managing freight planning, vendor coordination, shipment tracking, and cost control to ensure ...
Strong analytical skillsTMSAPICSAttention to detailExperience in purchase order PO management oversightFamiliarity with planning systems such as AnaplanProficiency in ERP tools including SAPARIBA

Admin Executive
Asian Paints Limited Fresher Chennai 28 Sep, 2025

Job Title: Admin Executive Location: Chennai Experience: purchase orderpurchasebillinginternational call centervendor managementmis reportingcustomer serviceprocurement negotiationprocurement executive

Civil Site Engineer
Ikamate HR India Pvt Ltd Fresher Ahmedabad 28 Sep, 2025

Were hiring for our Limited Company involved in Refrigeration Projects

Position: Civil Site Engineer

Location: Ahmedabad boqsite supervisionindustrial projectsindustrial engineering

SailPoint IIQ Senior Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 25 Sep, 2025

As a Senior Sailpoint Developer, you will be tasked with analyse, design and support implementation of business- specific Sailpoint solutions and/or framework. In addition, as Sailpoint developer...
devopssailpointsql

SailPoint IIQ Senior Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Noida, DelhiDelhi, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 25 Sep, 2025

As a Senior Sailpoint Developer, you will be tasked with analyse, design and support implementation of business- specific Sailpoint solutions and/or framework. In addition, as Sailpoint developer...
devopssailpointsql

Plant Operator at Dombivli.
Job Search Hiring For Pharmaceutical Company Fresher Mumbai City 25 Sep, 2025

Urgent job opening for Plant Operator at Dombivli. Experience: 3 to 4 years Description of Job Responsibilities plant operationsdeal with etp related disputesaccordance of cgmpplant operator

Import Executive
Aviyana Ventures Pvt Ltd Fresher Mumbai City, BoisarBoisar, Palghar, Mira Bhayandar, Vasai 25 Sep, 2025

Job Summary: The Import Executive is responsible for managing the entire process of importing goods from overseas suppliers. This includes coordinating with vendors, handling documentation, and...
import operationsimport clearanceimport managementimport documentationimport purchaseimport

SailPoint IIQ Senior Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Gurugram, DelhiDelhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 25 Sep, 2025

As a Senior Sailpoint Developer, you will be tasked with analyse, design and support implementation of business- specific Sailpoint solutions and/or framework. In addition, as Sailpoint developer...
devopssailpointsql

SailPoint IIQ Senior Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 25 Sep, 2025

As a Senior Sailpoint Developer, you will be tasked with analyse, design and support implementation of business- specific Sailpoint solutions and/or framework. In addition, as Sailpoint developer...
devopssailpointsql

Event manager
ASSETCARE SERVICES PRIVATE LIMITED Fresher Chandigarh, BangaloreBangalore, Purnia, Chennai, Raipur, Ghaziabad, Hyderabad, Gurugram, Faridabad, 25 Sep, 2025

An event managerplans, organizes, and oversees events like conferences, parties, and exhibitions, from initial concept and budgeting to on-site execution and post-event analys...
serviceleadershipmanagementnegotiationcommunicationcustomerbudgetingorganizationalskills

Software Tester - ERP Application
Shreeji Krupa Enterprise Fresher Ahmedabad, Gujarat 25 Sep, 2025

Role Overview: As a Software Tester at our company, you will be part of a team focusing on ERP applications used internationally, with a specific emphasis on Canada. Your primary responsibility wi...
Software TestingERPBug TrackingTest CasesSoftware DeploymentEnglish languageQA methodologies

Sous Chef
Tarasuns, A unit of Shree Ram Krupa Enterprise Fresher Vadodara, Gujarat 24 Sep, 2025

As a Sous Chef with a preferred background in Indian cuisine, you will be responsible for overseeing food production in all the kitchens, specifically focusing on large and multiple banquets. Your...
Indian CuisineMenu DevelopmentInventory ManagementFood ProductionVendor ManagementMenu PlanningStaff ManagementFood Cost AnalysisMarket SurveySocial Media MarketingBanquet ManagementFood Cost ControlMenu PricingHygieneSanitation Practices

Head of Finance and Accounting
Cremach Private Limited Fresher Vadodara, Gujarat 24 Sep, 2025

You will be responsible for ensuring all data is backed up and up to date to be available at the right time, in the right place, and in the right format. It will be essential to ensure cash and fu...
Advance MS ExcelTallyService TaxFinance relatoriescompliances Eg GST

Lead Engineer
SPENTO PAPERS (INDIA) LLP Fresher Udaipur, JaipurJaipur, Czech Republic, Ethiopia, Dominica, Agra, Dibrugarh, Varanasi, Kuwait, Rampur 24 Sep, 2025

Design Leadership & Management:

Lead and manage a team of engineers and designers within the [relevant discipline] to develop detailed designs for offsho...
offshore platformsoiloffshore oillifting operationsgaswell controllifting equipmentoffshore constructionunderbalanced drillingonshore operations

Import Executive
Aviyana Ventures Pvt Ltd Fresher Vasai, BoisarBoisar, Palghar, Mira Bhayandar, Mumbai City 24 Sep, 2025

Job Summary: The Import Executive is responsible for managing the entire process of importing goods from overseas suppliers. This includes coordinating with vendors, handling documentation, and...
import operationsimport clearanceimport managementimport documentationimport purchaseimport

Human Resources Executive
AllcargoGATI Fresher Surat, Gujarat 24 Sep, 2025

As an Executive - HR based in Surat Palsana location, your role will involve handling day-to-day HR operations and ensuring smooth coordination between teams and departments. Your key responsibili...
Employee EngagementVendor ManagementStrong interpersonalcommunication skillsAdvanced Excel for data analysisreportingTime Office operationslabor law compliance

Sr. Office / Executive for Accounts
A1 Human Wealth Management Private Limited Fresher Cuttack 24 Sep, 2025

As a Senior Officer/Executive for Account in the Manufacturing industry based in Orissa (Cuttack), you will be reporting to the Manager of Accounts & Finance. To qualify for this position, you sho...
SAP FICODebit NoteCredit NoteFixed Asset RegisterMicrosoft OfficeGSTR1GSTR3BGSTR2A Reconciliation

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Administrative Executive
SHRI BALAJI ENTERPRISES Fresher Bhubaneswar, BaddiBaddi, Indore, Kolkata, Jamshedpur, Pune, Mumbai City, Vadodara, Ahmedabad, Guwaha 24 Sep, 2025

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill

General Manager - Logistics Operations
FTJ Consultants Fresher Ranchi, JamshedpurJamshedpur, Patna, Kanpur, Lucknow, Kolkata, Durgapur 24 Sep, 2025

General Manager - Logistics Operations Role & Responsibilities: - Handling general administration of the assigned area and accountable for monitoring the overall sales operatio...
material managementwarehouse operationsfreightsupply chainsupply planning

Urgent Hiring Civil Site Engineer Fresher
Classic Enterprises Fresher Ranchi, GayaGaya, Hyderabad, Lucknow, Gurugram, Kolkata, Pune, Surat, Guwahati, Ahmedabad 24 Sep, 2025

Job Description Dear Job Seekers, Greetings of the day. We are recruiting for Civil Engineer Fresher can apply. only interested candidate send your resume or call to contact person. We have *...
autocadmonitoringconstructionsite engineeringms officecompliance monitoringcivil construction

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Raipur, BhubaneswarBhubaneswar, Cuttack, Jaipur, Sikar, Jodhpur, Kota, Udaipur, Ranchi, Bikaner 24 Sep, 2025

Machine learning engineers are responsible for putting data into machine learning models and deploying these models in production. Ingestion and preparation of data is a tricky task. It must be a...
software testingtestinghardware testingquality

Event manager
ASSETCARE SERVICES PRIVATE LIMITED Fresher Raipur, BangaloreBangalore, Purnia, Chennai, Ghaziabad, Hyderabad, Gurugram, Faridabad, Kakinada, Ch 24 Sep, 2025

An event managerplans, organizes, and oversees events like conferences, parties, and exhibitions, from initial concept and budgeting to on-site execution and post-event analys...
serviceleadershipmanagementnegotiationcommunicationcustomerbudgetingorganizationalskills

Assistant Sales Manager
Talent Leads HR Solutions Pvt Ltd Fresher Patna, RanchiRanchi, Bhubaneswar, Lucknow, Chandigarh, Bhopal 24 Sep, 2025

Job Description Description: Asst. Sales Manager Corporate and Private Sales Department: Sales && Business Development Experience Required: 5-6 years (Relevant Ex...
b2b saleschannel sales

Event Coordinator
JBS Event Management Group Fresher Punjab 24 Sep, 2025

As an event coordinator at JBS Event Management Group, you will be responsible for coordinating and executing event setups by closely working with vendors, production team, printing team, etc. You...
MS Office toolsRelationship managementEvent operationsGood communication skillsIndustry know howExtrovert natureConvincing attitudeTech savvyCoordinating

Purchase & Store Executive
SEQRONICS (INDIA) PRIVATE LIMITED Fresher Mysore 24 Sep, 2025

Position:Purchase Executive / Procurement Officer Experience:Minimum1 years Education:Diploma/BE in Electricals & Electronics...
dispatch planningpurchase management

ETP Operator
Enviro Care India Private Limited Fresher Madurai, Tamil Nadu 24 Sep, 2025

As an ETP Operator based in Madurai within the O&M department, you are required to have a minimum of 2 years of experience in this role. Your qualifications may include ITI, Diploma, or any Degree...
ETP operationschemical handlingequipment maintenancereport generationpollution control norms

Logistics Officer
SHARMA ENTERPRISES Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Guntakal, Anantpur, Dhubri, Dibrugarh, Guwahati 24 Sep, 2025

We are looking for a detail-oriented and organized Logistics Officer to join our team. The Logistics Officer will be responsible for coordinating the transportation, storage, and distribution of ...
supply chain managementcustomer serviceinventory managementproblem solvingadaptabilitylogistics managementdelivery operationsteamwork

Front Office Administrator
DLIFE Home Interiors Fresher Kochi, Kerala 24 Sep, 2025

As a detail-oriented and proactive professional, your role involves managing front office operations and assisting with daily administrative tasks. Your responsibilities include greeting and assis...
Administrative SupportCustomer ServiceCommunication SkillsProblem SolvingAdaptabilityOffice Operations ManagementMicrosoft Office SuiteOffice Management SoftwareOrganizational Abilities

Partner Service Manager
Strada Global Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: Join Strada on a journey of endless possibilities where unlocking potential for every colleague is the foundation of everything they do. With the support, resources, and opportuniti...
Change managementMS Office toolsInfluencing skillsDelivery modelsAttention to detailWritten

Pricing Specialist
HastenWay Shipping Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: You will be responsible for preparing competitive freight rates, handling rate negotiations, and coordinating with carriers and agents to secure the best possible deals. The ideal c...
NegotiationAnalytical SkillsCommunication SkillsMS OfficeCustomer Service

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Vacancy for Machine Learning Engineer
DEVIKA STAFFING SOLUTION Fresher Jodhpur, UdaipurUdaipur, Jaipur, Sikar, Kota, Bikaner, Bhubaneswar, Cuttack, Raipur, Ranchi 24 Sep, 2025

Machine learning engineers are responsible for putting data into machine learning models and deploying these models in production. Ingestion and preparation of data is a tricky task. It must be a...
software testingtestinghardware testingquality

Canteen Supervisor
ALTSEO PRIVATE LIMITED Fresher Jodhpur, KolarKolar, Rourkela, Jorethang, Ernakulam, Kottayam, Kolkata, Agartala, Surat, Silvassa 24 Sep, 2025

Job Description
Canteen Ops Administrator The Canteen Ops Administrator will supervise canteen operations in alignment with the agreed terms and conditions visa viz t...
canteen managementfood safety management systemfood manufacturingstaff managementfood safetyfood preparationleadership skillsmenu planningcustomer relationship

PREV
NEXT

deal with vendors Job Openings

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ... communicationofficemanagementadaptabilitysupporttimeorganisationalskill

Job Description

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

About the Role The Administrative Executive supports day-to-day office operations, facilitating efficient coordination among multiple departments. This role requires excellent organisational ...
communicationofficemanagementadaptabilitysupporttimeorganisationalskill