hybrid cloud jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

hybrid cloud Job Openings

Showing 4201 - 4250 of 14821 Jobs

Adobe Analytics(dashboardSQL)

LTIMindtree Limited Fresher Hyderabad 25 Sep, 2025

Adobe Campaign

Technical Architect Associate

Chetu India Pvt Ltd Fresher Noida 25 Sep, 2025

Job Summary

Senior Software Engineer 2

C3 India Delivery Centre LLP (formerly known as Crowe Horwath IT Services LLP) Fresher Noida, Uttar Pradesh 25 Sep, 2025

Microsoft technology stack

Senior Software Development Engineer 2

SBS Fresher Noida, Uttar Pradesh 25 Sep, 2025

Digital transformation

Agile methodologies

Microservices architecture

Reactive programming

Enterprisegrade components

ServiceNow SAM ITAM

MNR Solutions Pvt Ltd Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Pune, Delhi 25 Sep, 2025

servicenow

it asset management

itam

SAP Work Manager Developer

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

Adobe Analytics(dashboardSQL)

LTIMindtree Limited Fresher Chennai 25 Sep, 2025

Job Description

Adobe AnalyticsCampaign

Sales Development Representative

Live Connections Fresher Bangalore 25 Sep, 2025

business

sales development

sales department processes

RTR(Process Analyst)

Skywings Advisors Private Limited Fresher Bangalore 25 Sep, 2025

Qualification

Experience

Designation: rtraccrualsreconciliation

Sr. Data Engineer (Azure Synapse)
Versent Systems Ltd Fresher Ahmedabad, Gujarat 25 Sep, 2025

Role Overview: As a Senior Data Engineer with 5 to 8 years of experience and expertise in Azure Synapse and deep Azure data engineering, you will be responsible for designing and implementing data...
Data ArchitectsData engineeringAnalytical skillsAPIsDatabasesAzure DevOpsAzure SynapseAzure data engineeringData technologyData platform solutionsPresales ArchitectsCloud EngineersAzure data servicesProblemsolving skillsData pipelinesFile f

MERN Stack Developer
Arihant HR Consultancy Fresher Ahmedabad 25 Sep, 2025

Key Responsibilities

Develop and maintain end-to-end applications using MongoDB, Express.js, React.js, and Node.js.

Convert Figma/UI designs into responsive and interactive i...
restful apisawsnode.jsresponsive web designreact.jsexpress.js

Backend .NET Developer
AppleTech Fresher Vadodara, Gujarat 24 Sep, 2025

As a Web Application Developer at AppleTechSoft, you will be required to have a minimum of 5 years of hands-on experience in developing web applications on the Microsoft Windows Platform and cloud...
Software DesignArchitectureREST APIOODAOPSQL ServerSQL QueriesJOINSDatabase DesignLINQDebuggingAnalytical SkillsJAVASCRIPTDOJODockerMicrosoft TechnologiesVerbal CommunicationWritten CommunicationMicrosoft Windows PlatformCloud Technolog

Machine Learning Engineer
Sunflower Lab Fresher Vadodara, Gujarat 24 Sep, 2025

As a Machine Learning Engineer, you will be responsible for designing and implementing scalable machine learning models throughout the entire lifecycle - from data preprocessing to deployment. You...
PythonNumPySparkPandasScikitlearnTensorFlowPyTorchMLflowKubeflowDaskAWS SageMakerGCP AI PlatformWeightsBiasesDVCRay

MERN Full Stack Developer
Xcellence-IT Fresher Surat, Gujarat 24 Sep, 2025

You will be joining a dynamic and forward-thinking IT solutions company, Xcellence-IT, as a MERN Full Stack Developer. In this role, you will be responsible for designing, developing, and maintain...
JavaScriptHTML5CSS3MongoDBRESTful APIsWeb servicesAWSAzureMochaMERN stackExpressjsReactjsNodejsVersion control systemsAgile development methodologiesTypeScriptGraphQLCICD

Senior React.js Developer
Inventam Tech Solution ( OPC ) Fresher Surat, Gujarat 24 Sep, 2025

As a Senior React.js Developer at our innovative IT services company specializing in cutting-edge software solutions, you will be at the forefront of developing an advanced finance and trading app...
JavaScriptHTML5CSS3WebSocketsAWSAzureReactjsTypeScriptReduxMobXContext APIMaterial UIAnt DesignNextjsD3js

Tech Lead
Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Role Overview: STL Digital is seeking a talented SAP CO Consultant to join their team in Bhadrak. As a SAP CO Consultant, you will be responsible for leading or supporting SAP FICO module integrat...
Internal OrdersProduct CostingVariance AnalysisCost SheetFunctional specificationsUnit testingIntegration testingProduction supportIssue resolutionSAP CO ConsultantCost Center Accounting CCAProfit Center Accounting PCAProfitability Analysis CO

.NET Developer
FinJo Fresher Khordha 24 Sep, 2025

You are an accomplished .NET Developer with over 4 years of professional experience, responsible for designing, developing, and maintaining enterprise web applications at client project sites. You...
SQL ServerOOPSOLID principlesJavaScriptjQueryHTML5CSS3AzureAWSGitAgile methodologyNET CoreNET FrameworkASPNET MVCWeb APIEntity FrameworkEF CoreRESTful services

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Inside Sales Manager
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Mysore, ChennaiChennai, Bangalore, Madurai 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Senior Telesales Executive
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Madurai, ChennaiChennai, Bangalore, Mysore 24 Sep, 2025

Job Title: Senior Telesales Executive

Position Overview We are seeking a dynamic and results-driven Senior Telesales Executive to join our growing team. This role is pivotal in driv...
software marketingsoftware salestelesalestelemarketingtelecom salestelecalling

Inside Sales Manager
HALSEEON SOLUTIONS PRIVATE LIMITED Fresher Madurai, ChennaiChennai, Bangalore, Mysore 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

B2B Sales Intern
Exogenous Technology Fresher Ranchi, Jharkhand 24 Sep, 2025

Exogenous Technology is a leading provider of comprehensive digital solutions for businesses of all sizes, from small enterprises to large corporations. With a wealth of experience spanning over 5...
Customer ServiceSalesSales ManagementTrainingInterpersonal SkillsStrong Communication

Executive Chef
Tiffin Box Ranchi Fresher Ranchi, Jharkhand 24 Sep, 2025

The ideal candidate for this role is a seasoned chef who will be responsible for running an efficient kitchen. Your main tasks will include continually seeking ways to enhance the menu, ensuring t...
cheffinancial managementtrainingbudget constraintskitchen operations

Backe by DesignDgo Python Expert Senior Level
Inspire-I Solution Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Senior Python/Django Developer at our company based in Ahmedabad, India, you will be responsible for designing and building scalable backend solutions using Django, Python, and REST APIs. You...
PythonDjangoPostgreSQLMySQLOAuthGitDockerAWSGCPAzureRedisCeleryAngularREST APIsJWTCICD pipelinesReact

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Site Reliability Developer 4
Oracle Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Network Reliability Engineering (NRE) team at Oracle Cloud is responsible for ensuring the robustness of the Oracle Cloud Network Infrastructure. As a Network Reliability Engineer, your primar...
Network EngineeringMPLSBGPIPv6DNSDHCPSSLData Center designPythonScriptingAutomationNetwork monitoringNETCONFVxLANEVPNTelemetry solutionsYANG

Python / Gen AI Developer
LION AND ELEPHANTS CONSULTANCY PRIVATE LIMITED Fresher Erode, CoimbatoreCoimbatore, Chennai, Tambaram, Pudukottai, Dindigul, Namakkal, Kumbakonam, Bangalor 24 Sep, 2025

Job Overview: We are looking for an experienced and passionate Python/Gen AI Developer to join our team in Coimbatore. The ideal candidate will have strong expe...
pythoncloud awsartificial intelligencedjangoflaskllmsgenerative ailanggraphpyspark

Opportunity for Network Engineer Role in Coimbatore
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Coimbatore 24 Sep, 2025

We have an opening for a Network Engineer role based in Coimbatore. Please find the key details below: Experience: 4 to 12 years Location: Coimbatore Role Overview: This position involves L2 ...
wannetwork administration

Network Operations Lead - Coimbatore
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Coimbatore 24 Sep, 2025

Job Title: Network Operations Lead Experience: 12 to 18 years network administrationnetwork engineering

BDM Inventory Planning
SpareCare Inventory Solutions LLP Fresher Bhopal, BhubaneswarBhubaneswar, Kolkata, Delhi 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Business Development Manager (BDM) in Inventory Planning to join our team. This role is pivotal in optimizing ou...
supply chain managementpresentation skillsms excelparts orderingspare partsdemand forecastingbusiness analyticscommunication skills

Workday HCM Consultant
BISP Solutions Fresher Bhopal, Madhya Pradesh 24 Sep, 2025

Role Overview: You will be responsible for providing Workday HCM consulting services at our Bhopal office. Your primary focus will be on Workday Recruiting, including implementation support rollou...
Business ProcessSDLCTeam LeadershipCompensationSecurityWorkday RecruitingAgile project methodologiesWorkday HCMOrg Structures

Spring Boot Developer with AWS for Bangalore, Hyderabad and Pune
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Pune, BangaloreBangalore, Hyderabad 23 Sep, 2025

We are hiring experienced Spring Boot Developers with AWS experti...
microservicesrest apiawskubernetesdockeraws lambdaaws rdsaws ec2cloud deployment

Network Engineer - NAC or TAC
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 23 Sep, 2025

Position: Network Engineer - NAC or TAC Pre-requisite - Candidate should be well versed with Networking concepts and he should have at least 4 to 5 years of experience. Keyword...
tacroutingnacswitchingengineer

SAP DRC Consultant
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Mumbai City 23 Sep, 2025

Job Title: SAP DRC Consultant
Location: Mumbai, Pune and Banglore Experience: 414yrs Job Type: Full-t...
drccompliancesaphubdocument

Mlops Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Noida, DelhiDelhi, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 23 Sep, 2025

Location- PAN India Grade- C1 to C2 Exp- 6 to 12 Years Key Responsibilities: 1. Design, implement, and maintain end-to-end ML pipelines for model training, evaluation, and deployment 2. Collabor...
machine learningdockerpythonpipelinedevopskubernetesmlopstensorflowpytorchci/cd

Oracle SCM - Associate 2
PwC Acceleration Center India Fresher Hyderabad, Telangana 23 Sep, 2025

A career in our Advisory Acceleration Centre is the natural extension of PwCs leading class global delivery capabilities. We provide premium, cost-effective, high-quality services that support pro...
InventoryProcurementMaintenanceSCORImplementing Planning CentralCosting modulesOracle CloudSupply Chain Business Processes

Risk Consulting Analyst 2 - Managed Security
RSM US LLP Fresher Hyderabad, Telangana 23 Sep, 2025

You will be joining RSM, a leading provider of professional services to the middle market globally, with a focus on instilling confidence in a world of change and enabling clients and employees to...
IT operationsSecurity monitoringActive directoryIP networkingAutomationServiceNowNetFlowThreat intelligenceMalware analysisCybersecurityCloud technologiesSIEM toolsStellar CyberHyas InsightDNS ProtectSentinel OneELK StackVirus totalShoda

Mlops Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Gurugram, DelhiDelhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 23 Sep, 2025

Location- PAN India Grade- C1 to C2 Exp- 6 to 12 Years Key Responsibilities: 1. Design, implement, and maintain end-to-end ML pipelines for model training, evaluation, and deployment 2. Collabor...
machine learningdockerpythonpipelinedevopskubernetesmlopstensorflowpytorchci/cd

Mlops Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 23 Sep, 2025

Location- PAN India Grade- C1 to C2 Exp- 6 to 12 Years Key Responsibilities: 1. Design, implement, and maintain end-to-end ML pipelines for model training, evaluation, and deployment 2. Collabor...
machine learningdockerpythonpipelinedevopskubernetesmlopstensorflowpytorchci/cd

Java Backend developer
MNR Solutions Pvt Ltd Fresher Noida, BangaloreBangalore, Mumbai City 23 Sep, 2025

Dear Candidates, Currently looking for a Java Backend developer hiring for a Singapore based MNC On direct payroll Exp-5years NP-Immediate to 25th Aug before location-Noida, Mumbai Bangalore 5 ...
gcpapimicroservicesno sql

Software Development Engineer - 2 (NextJS UI Developer)
RateGain Fresher Noida, Uttar Pradesh 23 Sep, 2025

As a highly skilled and experienced Full Stack Developer with expertise in Next.js and .NET, you will be joining our engineering team to design, develop, and deploy scalable applications. Your rol...
JavaScriptNETLINQTypeScriptReactNextjsASPNET CoreEntity Framework CoreTailwind CSSRedux ToolkitZustandReact QueryOAuth2OpenID ConnectJWTAzure AD

Java Angular Fullstack Developer
Delta Sys-Tech (India) Pvt Ltd Fresher Chennai, BangaloreBangalore, Pune, Mumbai City 23 Sep, 2025

We are Hiring for Java Angular Full Stack Developer
Location:Bangalore, Chennai, Pune & Mumbai hibernatespringjavamicroservicesangularjavascriptfullstack developerjava developer

PREV
NEXT

hybrid cloud Job Openings

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m... market researchsales strategysales promotionsales administrationsalesmarketing

Job Title: Senior Telesales Executive

Position Overview We are seeking a dynamic and results-driven Senior Telesales Executive to join our growing team. This role is pivotal in driv... software marketingsoftware salestelesalestelemarketingtelecom salestelecalling

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m... market researchsales strategysales promotionsales administrationsalesmarketing

Job Title: SAP DRC Consultant

We are Hiring for Java Angular Full Stack Developer

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing

Position Overview We are seeking a dynamic and results-driven Senior Telesales Executive to join our growing team. This role is pivotal in driv...
software marketingsoftware salestelesalestelemarketingtelecom salestelecalling

Position Overview We are seeking a dynamic and results-driven Inside Sales Manager to join our team. This role is pivotal in driving our sales initiatives and expanding our m...
market researchsales strategysales promotionsales administrationsalesmarketing