supply chain domain jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

supply chain domain Job Openings

Showing 3501 - 3550 of 15104 Jobs

Dy Manager - SCPC Buying

Mahindra Group Fresher Rajkot, Gujarat 24 Sep, 2025

Communication Skills

Negotiation

Relationship Management

Cost Reduction Management

DABUR INDIA LIMITED

SLN ENTERPRISES Fresher Bhubaneswar, CuttackCuttack, Jharsuguda, Paradeep, Puri, Rourkela, Sambalpur, Bangalore, Odisha, Him 24 Sep, 2025

Contact Person

73.03.48.90.92

Dabur India limited

Hiring for Ware house Supervisor for one of leading FMCG company. warehouse operationsoder processinginventory managementdispatchinventory controlcommunication skillswarehouse managementsupply chain managementdistribution management

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

General Manager - Logistics Operations
FTJ Consultants Fresher Ranchi, JamshedpurJamshedpur, Patna, Kanpur, Lucknow, Kolkata, Durgapur 24 Sep, 2025

General Manager - Logistics Operations Role & Responsibilities: - Handling general administration of the assigned area and accountable for monitoring the overall sales operatio...
material managementwarehouse operationsfreightsupply chainsupply planning

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, JammuKashmir, Gujarat, Madhya Pradesh, Ahmednagar, Jharkhand, Karnataka, Himachal 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Area Service Incharge B
Reliance Jio Infocomm Limited Fresher Jalandhar, Punjab 24 Sep, 2025

As a Service Center Manager in our company located in Jalandhar, your role will involve: - Establishing and maintaining the upkeep of service centers - Liaising with store managers and sales team...
Team managementMarket knowledgeRelationship managementExperience in areazone for device repair operationsGeography knowledgeDelegation skillsDiversity managementDomain knowledge of telecom deviceExpertise in field repair operations

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Andhra Pradesh, BiharBihar, Gujarat, Haryana, Karnataka, Maharashtra, Punjab, Telangana, Uttar Prade 24 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Andhra Pradesh, BiharBihar, Gujarat, Haryana, Karnataka, Maharashtra, Punjab, Telangana, Uttar Prade 24 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Distribution Manager
TERCELHERBS PRIVATE LIMITED Fresher Kollam, GurugramGurugram, Mumbai City, Bangalore, Chennai, Noida, Hyderabad, Kolkata, Pune, Delhi 24 Sep, 2025

a distribution manageroversees the efficient, safe, and timely movement of products from point of origin to final destination, managing inventory, coordinating staff, optimiz...
chainoperationsmanagementsupplycommunication skillslogistics

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Logistics Officer
SHARMA ENTERPRISES Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Guntakal, Anantpur, Dhubri, Dibrugarh, Guwahati 24 Sep, 2025

We are looking for a detail-oriented and organized Logistics Officer to join our team. The Logistics Officer will be responsible for coordinating the transportation, storage, and distribution of ...
supply chain managementcustomer serviceinventory managementproblem solvingadaptabilitylogistics managementdelivery operationsteamwork

Content & Copywriting Intern/Trainee
Marketing as Sales support Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: As a part of MaSs, a digital marketing agency based in the UK with operations in Kochi, you will be part of a team that focuses on vibe marketing - creating messages that stand out,...
CopywritingContent CreationEditingGrammarAdaptabilityFeedbackCreativityAI Tools

Partner Service Manager
Strada Global Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: Join Strada on a journey of endless possibilities where unlocking potential for every colleague is the foundation of everything they do. With the support, resources, and opportuniti...
Change managementMS Office toolsInfluencing skillsDelivery modelsAttention to detailWritten

Restaurant Captain
ALTSEO PRIVATE LIMITED Fresher Kochi, AnantnagAnantnag, Bangalore, Jalore, Jabalpur, Moga, Kavaratti, Hassan, Coimbatore, Tuensang 24 Sep, 2025

Job description 1. Supervise the functions of the department employees, facilities smooth operations on a daily basis. 2. Ensures clean & safe work environment for team & Customers. 3. 80...
order takingrestaurant managementsafety complianceinventory controlmenu developmentoperationsleadership skillsoperations managementorder accuracy

Application Sales Jodhpur (IVD)
ACCUREX BIOMEDICAL PRIVATE LIMITED Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Application Sales Specialist at Accurex Biomedical in Jodhpur, you will be responsible for providing clinical application support and driving sales in the IVD domain. Your role will involve...
Application SupportSalesMarket IntelligenceDiagnostic InstrumentsCustomer Queries

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, Gujarat, Himachal Pradesh, JammuKashmir, Jharkhand, Karnataka, Madhya Pradesh, Ah 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Rigger opening
Apex Offshore Services Fresher Jamshedpur, IdukkiIdukki, Bellary, Karnal, Kollam, Palakkad, Kannur, Thrissur, Kakinada, Anantpur 24 Sep, 2025

Greeting We are hiring for the position of RIGGERwith a leading Oil & Gas Industry Job Responsibility:

-Responsible for th...
offshore platformsriggersrigrigrgerigesrigrsplatform

Housekeeping Assistant
ALTSEO PRIVATE LIMITED Fresher Koderma, Mumbai CityMumbai City, Gorakhpur, South Goa, Vellore, Rewa, Thiruvarur, Madhepura, Manali, 24 Sep, 2025

Housekeeping Assistant performs routine cleaning, maintenance, and restocking in residential or commercial settings, including hotels, healthcare facilities, and private homes, to ensure high sta...
housekeeping managementwaste managementroom serviceenvironmental serviceslaundry servicesreliabilitylaundry skillscleaning techniquesspecialized cleaning

Room Service Captain
ALTSEO PRIVATE LIMITED Fresher Chas, Mumbai CityMumbai City, Gwalior, Kolar, Samastipur, East Godavari, Imphal West, Kandla, Ganjam 24 Sep, 2025

Room Service Captain supervises room service operations by ensuring timely and accurate food and beverage delivery, training staff, managing guest relations, overseeing suppli...
culinary educationculinary managementmenu developmentsanitationrecipe developmentfoodinventory managementhotel managementguest servicebeverage

Estimation & Billing Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Jaipur, DelhiDelhi, Coimbatore, Zimbabwe, South Korea, Bangalore, Chennai, Netherlands, Poland, Hyde 24 Sep, 2025

We are looking for estimation engineer to Provides cost estimates/comparison costs for the value of goods that are provided by the supply chain and to collect and analyse...
estimation engineeringproject accountingcost accountingestimationfinal accountscost engineeringvariance analysiscost management

Team Lead- EXIM
AP Moller - Maersk Fresher Halol, Gujarat 24 Sep, 2025

As an Export Shipment Manager at Maersk Area Office, your role is crucial in delivering on the SCM Strategy within the specified geographical area. You will be responsible for managing End-to-End ...
MS Excel

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Business Development Consultant
Velodata Global Pvt Ltd Fresher Kochi, Kerala 24 Sep, 2025

As a Business Development Consultant for IT Services in Dubai, UAE, you will play a crucial role in expanding the companys presence in the region and beyond. Your primary responsibilities will inc...
Business DevelopmentIT servicesSales GrowthMarket TrendsLead GenerationMentoringPresalesMarketingCold CallingHubSpotIT SolutionsClient RelationshipsProposal PresentationsDeal Closing

Manager, Digital Services Sales/Sales Manager
Zyxware Technologies Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As a Sales Manager at Zyxware Technologies, you will play a crucial role in driving revenue generation from the assigned geographies. Your responsibilities will include identifying potential new c...
Sales strategiesSales planningForecastingConsultative sellingClient account managementValue chain analysisTeam buildingRevenue generationRisk managementCommunication skillsPresentation skillsMarket understandingSales process design

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Distribution Manager
TERCELHERBS PRIVATE LIMITED Fresher Kollam, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 24 Sep, 2025

a distribution manageroversees the efficient, safe, and timely movement of products from point of origin to final destination, managing inventory, coordinating staff, optimiz...
chainoperationsmanagementsupplycommunication skillslogistics

Relationship Officer
SKILLNIX RECRUITMENT SERVICES PRIVATE LIMITED Fresher Thrissur 24 Sep, 2025

Hiring Relationship Officer (Life Insurance) Thrissur | CTC 3.90 LPA Body: Dear Candidate, We are hiring for the position of Relationship Officer with a leading Life Insurance Company. salesbfsi salesfield sales

Estimation & Billing Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Coimbatore, ChennaiChennai, Hyderabad, Bangalore, Zimbabwe, South Korea, Jaipur, Netherlands, Poland 24 Sep, 2025

We are looking for estimation engineer to Provides cost estimates/comparison costs for the value of goods that are provided by the supply chain and to collect and analyse...
estimation engineeringproject accountingcost accountingestimationfinal accountscost engineeringvariance analysiscost management

Audit Manager
A K Salampuria & Associates | Chartered Accountants Fresher Patna, Bihar 24 Sep, 2025

As an Audit Manager at A K Salampuria & Associates, your role will involve leading and managing audit teams under the supervision of a Partner. You will be responsible for ensuring timely completi...
AuditBank AuditDirect TaxStatutory AuditInternal AuditConcurrent AuditTaxationInsurance Audit

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, Gujarat, Himachal Pradesh, JammuKashmir, Jharkhand, Karnataka, Madhya Pradesh, Ah 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Andhra Pradesh, BiharBihar, Gujarat, Haryana, Karnataka, Maharashtra, Punjab, Telangana, Uttar Prade 24 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

BDM Inventory Planning
SpareCare Inventory Solutions LLP Fresher Bhopal, BhubaneswarBhubaneswar, Kolkata, Delhi 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Business Development Manager (BDM) in Inventory Planning to join our team. This role is pivotal in optimizing ou...
supply chain managementpresentation skillsms excelparts orderingspare partsdemand forecastingbusiness analyticscommunication skills

Trading Manager
MNR Solutions Pvt Ltd Fresher Bhopal 24 Sep, 2025

Hiring for Trading Manager (Wheat /Grain) Location- Bhopal Exp- 7 Years Qualification -MBA Job Responsibility- General Description -...
tradingsupply chainlogisticsexport importinco terms

Operation manager intern
pH credit india finance private limited Fresher Agra, Uttar Pradesh 24 Sep, 2025

As an Operations Management Intern at PH Credit India Finance Private Limited, located in Sanjay Place, Agra, you will be an integral part of daily operational and administrative activities. You w...
MS ExcelAnalysisCommunication skillsData handlingAttention to detailProblemsolving

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 23 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Stock Clerk
NEW ERA LIFE CARE PRIVATE LIMITED Fresher Mangalore, BhubaneswarBhubaneswar, Vizianagaram, Bhagalpur, Rajahmundry, Kottayam, Sivasagar, Sangru 23 Sep, 2025

Job Summary We are looking for an organized and efficient stock clerk to join our growing business. As a stock clerk, you will manage receiving, storage, and distribution of mat...
order processingreceiving inspectionpurchase ordersmerchandising supply chaininventory managementproduct knowledgeregulatory complianceshelf stockingmaintaining stock records

Machine Design Engineer
Accupack Engineering Pvt Ltd Fresher Navi Mumbai, Maharashtra 23 Sep, 2025

As a Mechanical Engineer with 1-5 years of experience, you will be responsible for Drive Chain Calculation and Assembly Drawing in 3D based on the concept of 2D Drawing of Packaging Machines. Your...
SolidworksAutocadManufacturing ProcessMechanical Engineer

Oracle SCM - Associate 2
PwC Acceleration Center India Fresher Hyderabad, Telangana 23 Sep, 2025

A career in our Advisory Acceleration Centre is the natural extension of PwCs leading class global delivery capabilities. We provide premium, cost-effective, high-quality services that support pro...
InventoryProcurementMaintenanceSCORImplementing Planning CentralCosting modulesOracle CloudSupply Chain Business Processes

Executive QA - Manufacturing
Asian Paints Limited Fresher Hyderabad 23 Sep, 2025

Eligibility Criteria

manufacturinghandlingsopoperationsdocumentationmanpowerglpgooddcsgmpsystemsmesauditcompliancepractice

JD Edwards SND Consultant
LTIMindtree Limited Fresher Gurugram, DelhiDelhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 23 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 23 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

JD Edwards SND Consultant
LTIMindtree Limited Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 23 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Delhi, MaharashtraMaharashtra, Gujarat, Andhra Pradesh, Telangana, Haryana, Karnataka, Bihar, Punjab 23 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Oil & Gas Engineering Supervisor
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Mumbai City, Silvassa, Panaji 23 Sep, 2025

An Oil and Gas Engineer Supervisor oversees and coordinates activities on drilling rigs, production sites, or pipeline systems, leading teams of workers and engineers to ensure safety, efficiency...
hvacsupply chain managementproject managementpower plantssale management.detailing engineerhse managerstore managerchemical engineering structural design

Quality Assurance, Monitoring & Testing Analyst 2
Citi Fresher Chennai, Tamil Nadu 23 Sep, 2025

As a Business Risk and Control Analyst II at Citi, you will be a part of the Central Testing team within the Central Control Capabilities function. Your primary responsibility will be to drive Mon...
CommunicationControls AssessmentStakeholder ManagementAnalytical ThinkingAssurance StrategyConstructive DebateControls LifecyclePolicyProcedure

Store Manager Dabur India Limited
sk online services Fresher Ahmedabad, GujaratGujarat, JammuKashmir, Madhya Pradesh, Ahmednagar, Jharkhand, Karnataka, Bihar, Pa 23 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Associate Consultant
iMark Info360 Fresher Ahmedabad, Gujarat 23 Sep, 2025

As a part of iMark, you will be presented with exciting opportunities in diversified industry verticals and geographies. Whether you are an experienced professional or at the beginning of your car...
Finance

PPC - Engineer
Betonica HR Solution Fresher Ahmedabad, Gujarat 23 Sep, 2025

Job Title: PPC - Engineer Department: PPC Reports To: inventoryproductionppcallocationschedulingcapacitymanagementinventory controlresourcesupply chain managementsaperpplanningplanner

PREV
NEXT

supply chain domain Job Openings

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Eligibility Criteria

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation