oracle supply chain cloud jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

oracle supply chain cloud Job Openings

Showing 5801 - 5850 of 22814 Jobs

Senior React.js Developer

Inventam Tech Solution ( OPC ) Fresher Surat, Gujarat 24 Sep, 2025

Stock Audit Manager Retail Stores

Zion Corp Fresher Rajkot, Gujarat 24 Sep, 2025

Problemsolving skills

Attention to detail

Reporting skills

Retail stock management

Dy Manager - SCPC Buying

Mahindra Group Fresher Rajkot, Gujarat 24 Sep, 2025

Communication Skills

Negotiation

Relationship Management

Cost Reduction Management

Tech Lead

Sterlite Technologies Limited Fresher Bhadrak 24 Sep, 2025

Functional specifications

Cost Center Accounting CCA

Profit Center Accounting PCA

Profitability Analysis CO

.NET Developer

FinJo Fresher Khordha 24 Sep, 2025

NET CoreNET Framework

ASPNET MVC

Web API

Entity FrameworkEF Core

RESTful services

DABUR INDIA LIMITED

SLN ENTERPRISES Fresher Bhubaneswar, CuttackCuttack, Jharsuguda, Paradeep, Puri, Rourkela, Sambalpur, Bangalore, Odisha, Him 24 Sep, 2025

Contact Person

73.03.48.90.92

Dabur India limited

Hiring for Ware house Supervisor for one of leading FMCG company. warehouse operationsoder processinginventory managementdispatchinventory controlcommunication skillswarehouse managementsupply chain managementdistribution management

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

General Manager - Logistics Operations
FTJ Consultants Fresher Ranchi, JamshedpurJamshedpur, Patna, Kanpur, Lucknow, Kolkata, Durgapur 24 Sep, 2025

General Manager - Logistics Operations Role & Responsibilities: - Handling general administration of the assigned area and accountable for monitoring the overall sales operatio...
material managementwarehouse operationsfreightsupply chainsupply planning

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, JammuKashmir, Gujarat, Madhya Pradesh, Ahmednagar, Jharkhand, Karnataka, Himachal 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Data Science Trainee / Junior Data Scientist
Bloom Infotech Fresher Punjab 24 Sep, 2025

As a Data Science fresher, you will be part of our team where you will have the opportunity to apply your analytical and problem-solving skills on real-world datasets. You will collaborate closely...
PythonNumPySQLData VisualizationStatisticsProbabilityPandasScikitlearn

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Andhra Pradesh, BiharBihar, Gujarat, Haryana, Karnataka, Maharashtra, Punjab, Telangana, Uttar Prade 24 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Andhra Pradesh, BiharBihar, Gujarat, Haryana, Karnataka, Maharashtra, Punjab, Telangana, Uttar Prade 24 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Distribution Manager
TERCELHERBS PRIVATE LIMITED Fresher Kollam, GurugramGurugram, Mumbai City, Bangalore, Chennai, Noida, Hyderabad, Kolkata, Pune, Delhi 24 Sep, 2025

a distribution manageroversees the efficient, safe, and timely movement of products from point of origin to final destination, managing inventory, coordinating staff, optimiz...
chainoperationsmanagementsupplycommunication skillslogistics

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Workforce Services Senior Analyst (Capacity Planning)
Albireo Recruiters Hiring For Accenture Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Chittoor, Guntakal, Anantpur, Bangalore, Chenna 24 Sep, 2025

Role Workforce Services Senior Analyst (Capacity Planning) Responsible for developing and managing accurate mid to short-term Capacity planning models. These forecasts inform staffing, budgeting...
cross functional coordinationcapacity managementms excelshrinkage controlworkforce managementcontact centeroccupancy planningsla managementaht

Logistics Officer
SHARMA ENTERPRISES Fresher Kakinada, GunturGuntur, Hyderabad, Kurnool, Nellore, Guntakal, Anantpur, Dhubri, Dibrugarh, Guwahati 24 Sep, 2025

We are looking for a detail-oriented and organized Logistics Officer to join our team. The Logistics Officer will be responsible for coordinating the transportation, storage, and distribution of ...
supply chain managementcustomer serviceinventory managementproblem solvingadaptabilitylogistics managementdelivery operationsteamwork

Senior Front End Developer .NET
Milestone Technologies, Inc Fresher Kochi, Kerala 24 Sep, 2025

We are seeking a highly skilled Senior Front-End Developer who excels in constructing contemporary, responsive, and high-performance web applications. The ideal candidate possesses expertise in va...
JavaScriptHTML5CSS3AngularRESTful APIsnpmyarnAzure DevOpsGitDebuggingCommunicationCollaborationMicrosoft Razor UINET MVCTypeScriptReactVuejsNET CoreNET 6WebSocket integrationWebpackViteCICD pipelines

Partner Service Manager
Strada Global Fresher Kochi, Kerala 24 Sep, 2025

Role Overview: Join Strada on a journey of endless possibilities where unlocking potential for every colleague is the foundation of everything they do. With the support, resources, and opportuniti...
Change managementMS Office toolsInfluencing skillsDelivery modelsAttention to detailWritten

Restaurant Captain
ALTSEO PRIVATE LIMITED Fresher Kochi, AnantnagAnantnag, Bangalore, Jalore, Jabalpur, Moga, Kavaratti, Hassan, Coimbatore, Tuensang 24 Sep, 2025

Job description 1. Supervise the functions of the department employees, facilities smooth operations on a daily basis. 2. Ensures clean & safe work environment for team & Customers. 3. 80...
order takingrestaurant managementsafety complianceinventory controlmenu developmentoperationsleadership skillsoperations managementorder accuracy

Executive Chef
Tiffin Box Ranchi Fresher Ranchi, Jharkhand 24 Sep, 2025

The ideal candidate for this role is a seasoned chef who will be responsible for running an efficient kitchen. Your main tasks will include continually seeking ways to enhance the menu, ensuring t...
cheffinancial managementtrainingbudget constraintskitchen operations

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, Gujarat, Himachal Pradesh, JammuKashmir, Jharkhand, Karnataka, Madhya Pradesh, Ah 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Rigger opening
Apex Offshore Services Fresher Jamshedpur, IdukkiIdukki, Bellary, Karnal, Kollam, Palakkad, Kannur, Thrissur, Kakinada, Anantpur 24 Sep, 2025

Greeting We are hiring for the position of RIGGERwith a leading Oil & Gas Industry Job Responsibility:

-Responsible for th...
offshore platformsriggersrigrigrgerigesrigrsplatform

Housekeeping Assistant
ALTSEO PRIVATE LIMITED Fresher Koderma, Mumbai CityMumbai City, Gorakhpur, South Goa, Vellore, Rewa, Thiruvarur, Madhepura, Manali, 24 Sep, 2025

Housekeeping Assistant performs routine cleaning, maintenance, and restocking in residential or commercial settings, including hotels, healthcare facilities, and private homes, to ensure high sta...
housekeeping managementwaste managementroom serviceenvironmental serviceslaundry servicesreliabilitylaundry skillscleaning techniquesspecialized cleaning

Room Service Captain
ALTSEO PRIVATE LIMITED Fresher Chas, Mumbai CityMumbai City, Gwalior, Kolar, Samastipur, East Godavari, Imphal West, Kandla, Ganjam 24 Sep, 2025

Room Service Captain supervises room service operations by ensuring timely and accurate food and beverage delivery, training staff, managing guest relations, overseeing suppli...
culinary educationculinary managementmenu developmentsanitationrecipe developmentfoodinventory managementhotel managementguest servicebeverage

Estimation & Billing Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Jaipur, DelhiDelhi, Coimbatore, Zimbabwe, South Korea, Bangalore, Chennai, Netherlands, Poland, Hyde 24 Sep, 2025

We are looking for estimation engineer to Provides cost estimates/comparison costs for the value of goods that are provided by the supply chain and to collect and analyse...
estimation engineeringproject accountingcost accountingestimationfinal accountscost engineeringvariance analysiscost management

Backe by DesignDgo Python Expert Senior Level
Inspire-I Solution Fresher Ahmedabad, Gujarat 24 Sep, 2025

As a Senior Python/Django Developer at our company based in Ahmedabad, India, you will be responsible for designing and building scalable backend solutions using Django, Python, and REST APIs. You...
PythonDjangoPostgreSQLMySQLOAuthGitDockerAWSGCPAzureRedisCeleryAngularREST APIsJWTCICD pipelinesReact

Team Lead- EXIM
AP Moller - Maersk Fresher Halol, Gujarat 24 Sep, 2025

As an Export Shipment Manager at Maersk Area Office, your role is crucial in delivering on the SCM Strategy within the specified geographical area. You will be responsible for managing End-to-End ...
MS Excel

Specialist I - SE - React , Typescript
UST Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Lead Software Engineer within our enterprise product domain, you will play a pivotal role as both an expert individual contributor and a technical multiplier. You will be respo...
JavascriptReactJsNodeJs

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Technical lead
Kalki Communication Technologies Fresher Kochi, Kerala 24 Sep, 2025

As a Technical Lead - Manual Testing, you will be responsible for leading a team of 4-6 members, preparing test plans, and developing test cases based on RTM. Your knowledge on IEC protocols, Linu...
Manual testingLinuxOracleSQL ServerMySQLTomcatJBossJIRABugzillaConfiguration ManagementWeb application testingIEC protocols

Fullstack Developer
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Kochi 24 Sep, 2025

Required Skills & Qualifications 8 to 12 years of experience in software development with strong Java, Spring Boot expertise. Proven experience in designing microservices and distributed system...
javadeveloperspringboot

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Junior Finance Executive
Arbor Education Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Junior Finance Executive plays a crucial role within the finance team by supporting day-to-day operations, ensuring accuracy in financial transactions, and contributing to compliance and repor...
Financial operationsReportingComplianceIndian accounting standardsGSTTDSMS ExcelGoogle SheetsAccounting softwareAnalytical skillsWritten communicationVerbal communicationDirect tax rulesAttention to detailMonthend closingReconciliationsAud

Research and Development Product Manager
First Screen Fresher Kochi, Kerala 24 Sep, 2025

As a Research and Development Product Manager at our company, you will play a crucial role in establishing and leading a new Research & Development unit. You will be responsible for bridging the g...
Team LeadershipProduct DevelopmentStakeholder ManagementAgile MethodologiesLeadershipProduct OwnershipSoftware Development ProcessesCloud TechnologiesEnglish CommunicationProblemSolving

Manager, Digital Services Sales/Sales Manager
Zyxware Technologies Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As a Sales Manager at Zyxware Technologies, you will play a crucial role in driving revenue generation from the assigned geographies. Your responsibilities will include identifying potential new c...
Sales strategiesSales planningForecastingConsultative sellingClient account managementValue chain analysisTeam buildingRevenue generationRisk managementCommunication skillsPresentation skillsMarket understandingSales process design

Workday Finance Techno-functional Consultant Senior
Butterfly Groups Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

Role Overview: As a Workday Finance Techno-functional Consultant at our company, you will play a crucial role in leading or supporting Workday Financials implementations and post-go-live activitie...
Web ServicesSOAPRESTXMLXSLTJSONMatrixBIRTWorkday StudioEIBCore ConnectorsWorkday Prism AnalyticsAccounting CenterWorkday SecurityBusiness Process ConfigurationWorkday ReportingCompositeAdvancedDiscovery BoardsCalculated Fields

Site Reliability Developer 4
Oracle Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

The Network Reliability Engineering (NRE) team at Oracle Cloud is responsible for ensuring the robustness of the Oracle Cloud Network Infrastructure. As a Network Reliability Engineer, your primar...
Network EngineeringMPLSBGPIPv6DNSDHCPSSLData Center designPythonScriptingAutomationNetwork monitoringNETCONFVxLANEVPNTelemetry solutionsYANG

Distribution Manager
TERCELHERBS PRIVATE LIMITED Fresher Kollam, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 24 Sep, 2025

a distribution manageroversees the efficient, safe, and timely movement of products from point of origin to final destination, managing inventory, coordinating staff, optimiz...
chainoperationsmanagementsupplycommunication skillslogistics

Python / Gen AI Developer
LION AND ELEPHANTS CONSULTANCY PRIVATE LIMITED Fresher Erode, CoimbatoreCoimbatore, Chennai, Tambaram, Pudukottai, Dindigul, Namakkal, Kumbakonam, Bangalor 24 Sep, 2025

Job Overview: We are looking for an experienced and passionate Python/Gen AI Developer to join our team in Coimbatore. The ideal candidate will have strong expe...
pythoncloud awsartificial intelligencedjangoflaskllmsgenerative ailanggraphpyspark

Estimation & Billing Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Coimbatore, ChennaiChennai, Hyderabad, Bangalore, Zimbabwe, South Korea, Jaipur, Netherlands, Poland 24 Sep, 2025

We are looking for estimation engineer to Provides cost estimates/comparison costs for the value of goods that are provided by the supply chain and to collect and analyse...
estimation engineeringproject accountingcost accountingestimationfinal accountscost engineeringvariance analysiscost management

Store Manager Dabur India Limited
sk online services Fresher Patna, BiharBihar, Gujarat, Himachal Pradesh, JammuKashmir, Jharkhand, Karnataka, Madhya Pradesh, Ah 24 Sep, 2025

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Gold Inspector
MUTHOOT FINCORP LIMITED Fresher Andhra Pradesh, BiharBihar, Gujarat, Haryana, Karnataka, Maharashtra, Punjab, Telangana, Uttar Prade 24 Sep, 2025

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

BDM Inventory Planning
SpareCare Inventory Solutions LLP Fresher Bhopal, BhubaneswarBhubaneswar, Kolkata, Delhi 24 Sep, 2025

Position Overview We are seeking a dynamic and results-driven Business Development Manager (BDM) in Inventory Planning to join our team. This role is pivotal in optimizing ou...
supply chain managementpresentation skillsms excelparts orderingspare partsdemand forecastingbusiness analyticscommunication skills

Workday HCM Consultant
BISP Solutions Fresher Bhopal, Madhya Pradesh 24 Sep, 2025

Role Overview: You will be responsible for providing Workday HCM consulting services at our Bhopal office. Your primary focus will be on Workday Recruiting, including implementation support rollou...
Business ProcessSDLCTeam LeadershipCompensationSecurityWorkday RecruitingAgile project methodologiesWorkday HCMOrg Structures

Trading Manager
MNR Solutions Pvt Ltd Fresher Bhopal 24 Sep, 2025

Hiring for Trading Manager (Wheat /Grain) Location- Bhopal Exp- 7 Years Qualification -MBA Job Responsibility- General Description -...
tradingsupply chainlogisticsexport importinco terms

Operation manager intern
pH credit india finance private limited Fresher Agra, Uttar Pradesh 24 Sep, 2025

As an Operations Management Intern at PH Credit India Finance Private Limited, located in Sanjay Place, Agra, you will be an integral part of daily operational and administrative activities. You w...
MS ExcelAnalysisCommunication skillsData handlingAttention to detailProblemsolving

Spring Boot Developer with AWS for Bangalore, Hyderabad and Pune
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Pune, BangaloreBangalore, Hyderabad 23 Sep, 2025

We are hiring experienced Spring Boot Developers with AWS experti...
microservicesrest apiawskubernetesdockeraws lambdaaws rdsaws ec2cloud deployment

Network Engineer - NAC or TAC
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 23 Sep, 2025

Position: Network Engineer - NAC or TAC Pre-requisite - Candidate should be well versed with Networking concepts and he should have at least 4 to 5 years of experience. Keyword...
tacroutingnacswitchingengineer

SAP DRC Consultant
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Mumbai City 23 Sep, 2025

Job Title: SAP DRC Consultant
Location: Mumbai, Pune and Banglore Experience: 414yrs Job Type: Full-t...
drccompliancesaphubdocument

PREV
NEXT

oracle supply chain cloud Job Openings

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job Title: Store Manager Company: Dabur India Limited leadershipmanagementcommunication skillsmaterial receiptstore managementdispatchwarehouse operationsstock control

Job description Main Tasks Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job Title: SAP DRC Consultant

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation

Job description Main Tasks

Physical verification of Gold Packets, Cash including Vault Cash and Foreign Currency as to its correctness with the system records. gold appraisinggoldgold valuation