closures jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

closures Job Openings

Showing 101 - 150 of 527 Jobs

HR Recruitment Executive

Accord Synergy Ltd Fresher Vadodara 20 Dec, 2025

Accord Synergy Ltd., near Natubhai Cir...
screeningstaffingtalent acquisitionrecruitmentsourcing

Sales Engineer
42SIGNS INFOSYSTEMS LLP Fresher Chennai 20 Dec, 2025

Designation: SalesEngineer (Sealant Dispensing & Airless Spray Coating Solutions)

Location: Chennai (Sriperumbudur), India fieldservicesales

Hiring Assistant Manager Talent Acquisition ( Non-IT | 6 - 10 years) - Hyd
Venpa Global Technologies Private Limited Fresher Hyderabad 17 Dec, 2025

Hiring: Assistant Manager Talent Acquisition (Non-IT | High Priority)
L...
volume hiringfund accountingtalent acquisitioninvestment bankingnon it skills

Customer Service Executive
Veerwal Getwork Services Private Limited Fresher Bangalore, Tamil Nadu 17 Dec, 2025

Customer Service Executive Role Overview We are looking for a motivated Customer Service Executive to support our Vehicle Finance operations. This role focuses on assisting customers through the...
customer servicelead generation

Medical Sales Officer (Device sales)
MAPLE DIGITAL TECHNOLOGY INTERNATIONAL PRIVATE LIMITED Fresher Pune, Mumbai CityMumbai City, Ahmedabad 08 Dec, 2025

Job Title: Area Sales Officer Mumbai Company: Rymo Technologies Pvt Ltd Employment Type: Full-time Working Days: 6 days a week (10 AM 7 PM) About Rymo Rymo Technologies Pvt Ltd is a pioneering he...
medical salesmedical equipment sales

Key Account Manager
cars24 financial services Fresher Pune, Mumbai City 08 Dec, 2025

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
dealer channel managementb2b saleslead generationdealer handling

Key Account Manager
cars24 financial services Fresher Ahmedabad 08 Dec, 2025

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
field salesdealer handlingdealer channel managementb2b sales

Key Account Manager
cars24 financial services Fresher Mumbai City, Pune 07 Dec, 2025

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
dealer channel managementb2b saleslead generationdealer handling

Key Account Manager
cars24 financial services Fresher Delhi 07 Dec, 2025

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
lead generationdealer salesb2b salesdealer handling

Manager - Retail Sales
Taggd Fresher Ranchi 05 Dec, 2025

Manager - Retail Sales

Position Overvi...
product launchsalesdealer developmentmarket sizingteam handling

Key Account Manager
cars24 financial services Fresher Gurugram, Noida 03 Dec, 2025

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
field salesdealer handlingb2b saleslead generation

Key Account Manager
cars24 financial services Fresher Noida, Gurugram 03 Dec, 2025

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
field salesdealer handlingb2b saleslead generation

C2C Sales Associate
cars24 financial services Fresher Bangalore 03 Dec, 2025

Job Role:Customer to Customer (C2C) Associate Location: Gurgaon & Bangalore customer acquisitioncar salesautomobilenegotiationdeal closuretelesalescustomer service

Assistant Manager - Talent Acquisition
AltF CoWorking Fresher Haryana 30 Nov, 2025

As a Talent Acquisition/Recruitment professional, you will be responsible for managing the end-to-end hiring process to select quality talent and ensure timely recruitment of staff and workers wit...
Talent AcquisitionRecruitmentScreeningInterviewingOnboardingTraining ProgramsSourcingStrategic HiringMappingBudget ManagementQuantitative ResearchQualitative ResearchInterpersonal SkillsCommunication Skills

Manager F&A (Business Finance)
Taggd Fresher Mumbai City 28 Nov, 2025

Manager F&A (Business Finance)
Requisition Code: ITC/M-/ controlcostaccountingmisreportingsapbudgeting

Real Estate Sales Consultant
Beyond Sqft Fresher Patna, Bihar 22 Nov, 2025

Role Overview: You will be joining Beyond Sqft as a Real Estate Sales Executive, based in Patna, Bihar. Beyond Sqft is a dynamic real estate advisory firm specializing in residential, commercial, ...
SalesClient Relationship ManagementNegotiationMarket Research

Agency Manager
ASTIN CONSULTANCY SERVICES PRIVATE LIMITED Fresher Kochi 22 Nov, 2025

Job Title: Agency Manager Location:Kochi Education: ...
team leadershipagent recruitment

Business Development Manager (IT Service Pref)
POST A RESUME Hiring For IT Service based Company Fresher Gandhinagar 22 Nov, 2025

Greeting from POST A RESUME, We are currently hiring for Business Development Manager post in Gandhinagar. Company Profile: Since30 years catering services in IT Technology domain with India...
lead generationinternational salesweb developmentproposal developmentit services salesmobile application developmentcustomizationteam handling

Business Development Manager
ASTIN CONSULTANCY SERVICES PRIVATE LIMITED Fresher Kochi 21 Nov, 2025

Job Title: Business Development Manager Location: Kochi Educa...
revenue growth generationmarketingsaleslead generation

Sales Engineer
42SIGNS INFOSYSTEMS LLP Fresher Chennai 10 Nov, 2025

Designation: SalesEngineer (Sealant Dispensing & Airless Spray Coating Solutions)

Location: Chennai (Sriperumbudur), India fieldservicesales

Hiring IT & Non-IT Recruiters | White Horse Manpower Consultancy Pvt. Ltd
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Bangalore 10 Nov, 2025

Hiring: IT & Non-IT Recruiters | White Horse Manpower Consultancy Pvt. Ltd. | 19-Year-Old Recruitment Firm | Salary Up to 4 LPA | Immediate Joining White Hor...
non-it recruiterrecruitmentindiarecruitment consultantimmediate joinershr executiverecruiterit recruiterhiring recruiters bangalorewhite horse manpower careershr recruiter

Key Account Manager
cars24 financial services Fresher Pune, Mumbai City 07 Nov, 2025

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
dealer channel managementb2b saleslead generationdealer handling

Key Account Manager
cars24 financial services Fresher Ahmedabad 05 Nov, 2025

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
field salesdealer handlingdealer channel managementb2b sales

Hiring Assistant Manager Talent Acquisition ( Non-IT | 6 - 10 years) - Hyd
Venpa Global Technologies Private Limited Fresher Hyderabad 03 Nov, 2025

Hiring: Assistant Manager Talent Acquisition (Non-IT | High Priority)
L...
volume hiringfund accountingtalent acquisitioninvestment bankingnon it skills

Sales Executive- Real estate
Rishabh Builders Pvt Limited Fresher Raipur 31 Oct, 2025

As a Real Estate Sales Executive at our company, you will have the following responsibilities: - Handling clients and accompanying them on property visits - Following instructions from managers t...
SalesCustomer Relationship ManagementLead ManagementPresentation SkillsNegotiation SkillsMS ExcelMS OfficeReal EstateTarget DrivenResult Oriented

Investment Manager
Square Yards Consulting Private Limited Fresher Delhi, Gurugram 28 Oct, 2025

Job description Job Title: Sales Executive Location: Gurugram, India Qualification: Minimum Graduation Experience: 6 months in Sales Employment Type: Full-time Roles & Responsibilities: Ma...
b2c salessalesfield sales

Education Counsellor
NEXELEVATE RECRUITMENT LLP Fresher Noida 28 Oct, 2025

Location: Noida Sector 63 Work from Office Industry Domain: EdTech (Education Technology) Job Type: Full-time Experience: 0-...
academic consultingedtechcold callingeducational salessalescounselling

Investment Manager
Square Yards Consulting Private Limited Fresher Gurugram, Delhi 28 Oct, 2025

Job description Job Title: Sales Executive Location: Gurugram, India Qualification: Minimum Graduation Experience: 6 months in Sales Employment Type: Full-time Roles & Responsibilities: Ma...
b2c salessalesfield sales

Infor LN Functional Consultant
Best Infosystems Ltd Fresher Mumbai City, PunePune, Bangalore, Noida, Chennai, Hyderabad 23 Oct, 2025

Infor LN Functional Consultant_Full-Time_Bangalore/Pune/Navi Mumbai/Noida/Hyderabad/Chennai(Hybrid) Job Title: Infor LN Functional Consultant Job Type: Full-Time Location: Bangalore/Pune/Navi Mu...
bodsxml

Research Analyst 2
Demandbase Fresher Hyderabad, Telangana 23 Oct, 2025

Demandbase is the Smarter GTM company for B2B brands, assisting marketing and sales teams in overcoming disruptive data and technology fragmentation that inhibits insight and forces spamming of pr...
Data ResearchData AnalysisMS OfficeData VisualizationCommunication SkillsInterpersonal SkillsBusiness Research MethodologiesReporting Writing

Software Developer-Angular
Meganar Technologies Fresher Madurai, Tamil Nadu 19 Oct, 2025

As a candidate for the position, you should have the following qualifications: - Qualification: BCA, BSC, BE/BTECH (CS/IT/ECE), MCA/MSc - Experience: 0 - 2 years in AngularJS projects Key Respon...
MeteorSailAWSObjectsClosuresGitAnalytical skillProblemsolving skillsAngularReactJSNodeJsJavaScript serverWeb Socket APIsJS Backend frameworkExpress JSKoaadvanced JavaScript concepts

Sales Associate
Square Yards Consulting Private Limited Fresher Hyderabad 19 Oct, 2025

Job Title: Relationship Manager Real Estate Sales (B2C) Location: Hyderabad, India Industry: Real Estate Job Type: Full-Time Experience Required: Minimum 1 year into real-estate sales or ...
real estate salessalesconvincing peoplenegotiation

Regional Head Sales
Little Millennium Education Pvt Ltd Fresher Kochi, Kerala 19 Oct, 2025

Millennium Group is a leading player in K-12 education in India, operating K-12 schools and preschools with a focus on excellence. The groups pre-school brand, Little Millennium, is known for its ...
Franchise SalesBusiness DevelopmentLeadershipSales ManagementNegotiationMarket AnalysisTeam ManagementCommunication Skills

Recruitment Specialist
Bajaj Finance Limited Fresher Chandigarh, Mumbai City 19 Oct, 2025

Job Description Position: Recruiter Experience: 1-3 years in hiring (preferably non-Tech hiring) Work Mode: Work from o...
sourcing profilesscreeningrecruitmenttalent acquisition

Product Specialist in Machine Tools Senior Manager or Manager in BLR or CHE
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Chennai, Bangalore 14 Oct, 2025

We are seeking an experienced and motivated Product Specialist Machine...
oem salesmachine parts saleshmcslip ringsoem clientsproduct specialist machine toolsvmcrotary unionsmachine tooling

Title US Sales Closures Associate (Hardcore Sales)
Sharda Consultancy Services Hiring For Job Title: US Sales Closures Associate (Hardcore Sales) Fresher Gurugram 10 Oct, 2025

Job Title: US Sales Closures Associate (Hardcore Sales) Location: B2C Model (Work from Office/) Shift: US EST Hours (7:00 PM IST 4:30 AM IST, Daylight Saving aware) Direct Line Up: 4 PM 8 PM H...
lead qualification conversioninbound call handling

Infor LN Functional Consultant
Best Infosystems Ltd Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Pune, Mumbai City 10 Oct, 2025

Infor LN Functional Consultant_Full-Time_Bangalore/Pune/Navi Mumbai/Noida/Hyderabad/Chennai(Hybrid) Job Title: Infor LN Functional Consultant Job Type: Full-Time Location: Bangalore/Pune/Navi Mu...
bodsxml

Real Estate - Sales Manager
Moneytree Realty Services Limited Fresher Noida, DelhiDelhi, Ghaziabad 08 Oct, 2025

Position: Sales Manager Real Estate Location: Noida (Sector 63 & Sector 126) commercial salessalesresidential salesreal estate salessales officersales executive

Executive Assistant
ARM & HAMMER FORGINGS PVT LTD Fresher Faridabad 08 Oct, 2025

Excellent organizational and time management skills. Strong follow-up ability with persistence and tact. Proficiency in MS Office Suite (Excel, Word, PowerPoint, Outlook) and collaboration tool...
skilled multi-taskercommunicationgoogle sheetsfollow ups

Inside Sales Manager
ONE5 KNOWLEDGE VENTURES PRIVATE LIMITED Fresher Delhi, Gurugram 08 Oct, 2025

Designations offered:Management Trainee/ Asst Manager/ Deputy Manager/ Manager Profile:B2B sales, pre sales mostly calling and corporate meetings, Inside sales,...
presalessales managementclient acquisitioninside salesclient handlingrelationship managementcorporate meetingsb2b salesmanagement trainee

Relationship Officer
Veerwal Getwork Services Private Limited Fresher Delhi 08 Oct, 2025

About the Role
We are looking for a motivated and result-driven Relatio...
casa salessales

Hiring IT & Non-IT Recruiters | White Horse Manpower Consultancy Pvt. Ltd
WHITE HORSE MANPOWER CONSULTANCY (P) LTD Fresher Bangalore 08 Oct, 2025

Hiring: IT & Non-IT Recruiters | White Horse Manpower Consultancy Pvt. Ltd. | 19-Year-Old Recruitment Firm | Salary Up to 4 LPA | Immediate Joining White Hor...
non-it recruiterrecruitmentindiarecruitment consultantimmediate joinershr executiverecruiterit recruiterhiring recruiters bangalorewhite horse manpower careershr recruiter

Infor LN Functional Consultant
Best Infosystems Ltd Fresher Pune, BangaloreBangalore, Noida, Chennai, Hyderabad, Mumbai City 05 Oct, 2025

Infor LN Functional Consultant_Full-Time_Bangalore/Pune/Navi Mumbai/Noida/Hyderabad/Chennai(Hybrid) Job Title: Infor LN Functional Consultant Job Type: Full-Time Location: Bangalore/Pune/Navi Mu...
bodsxml

Infor LN Functional Consultant
Best Infosystems Ltd Fresher Noida, BangaloreBangalore, Chennai, Hyderabad, Pune, Mumbai City 03 Oct, 2025

Infor LN Functional Consultant_Full-Time_Bangalore/Pune/Navi Mumbai/Noida/Hyderabad/Chennai(Hybrid) Job Title: Infor LN Functional Consultant Job Type: Full-Time Location: Bangalore/Pune/Navi Mu...
bodsxml

Infor LN Functional Consultant
Best Infosystems Ltd Fresher Hyderabad, BangaloreBangalore, Noida, Chennai, Pune, Mumbai City 01 Oct, 2025

Infor LN Functional Consultant_Full-Time_Bangalore/Pune/Navi Mumbai/Noida/Hyderabad/Chennai(Hybrid) Job Title: Infor LN Functional Consultant Job Type: Full-Time Location: Bangalore/Pune/Navi Mu...
bodsxml

Sales Manager - Real estate
Moneytree Realty Services Limited Fresher Gurugram, Noida 01 Oct, 2025

Job Title: Sales Manager Real Estate Location: (Sector 63, Sector 126) Noida Company: Money Tree Realty Services Limited Employment Type: Full-time About the Role We are looking for an experien...
team managementchannel partner managementresidential salesreal estate salesbusiness developmentcommercial salesclient acquisitionteam handling

Sales Manager - Real estate
Moneytree Realty Services Limited Fresher Noida, Gurugram 01 Oct, 2025

Job Title: Sales Manager Real Estate Location: (Sector 63, Sector 126) Noida Company: Money Tree Realty Services Limited Employment Type: Full-time About the Role We are looking for an experien...
team managementchannel partner managementresidential salesreal estate salesbusiness developmentcommercial salesclient acquisitionteam handling

RTR(Process Analyst)
Skywings Advisors Private Limited Fresher Bangalore 25 Sep, 2025

Job details: QualificationBcom,Bba,Bbm,Mba.Mcom Experienceminimum 1 years into RTR & Reconciliation Designation: rtraccrualsreconciliation

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Relationship Officer - Banca
SkillLabs Fresher Jodhpur, Rajasthan 24 Sep, 2025

As an Execution specialist, your primary responsibility will be to analyze customer segmentation and sales trends to evaluate business potential. You will conduct training sessions at branch locat...
Customer segmentationRelationship managementService orientationTeam collaborationIssue resolutionSales experienceSales trends analysisCross sell opportunities identification

PREV
NEXT

closures Job Openings

Hiring: Assistant Manager Talent Acquisition (Non-IT | High Priority)

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke... dealer channel managementb2b saleslead generationdealer handling

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke... field salesdealer handlingdealer channel managementb2b sales

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke... dealer channel managementb2b saleslead generationdealer handling

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke... lead generationdealer salesb2b salesdealer handling

Manager - Retail Sales

Position Overvi... product launchsalesdealer developmentmarket sizingteam handling

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke... field salesdealer handlingb2b saleslead generation

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke... field salesdealer handlingb2b saleslead generation

Manager F&A (Business Finance)

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke... dealer channel managementb2b saleslead generationdealer handling

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke... field salesdealer handlingdealer channel managementb2b sales

Hiring: Assistant Manager Talent Acquisition (Non-IT | High Priority)

About the Role

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
dealer channel managementb2b saleslead generationdealer handling

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
field salesdealer handlingdealer channel managementb2b sales

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
dealer channel managementb2b saleslead generationdealer handling

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
lead generationdealer salesb2b salesdealer handling

Position Overvi...
product launchsalesdealer developmentmarket sizingteam handling

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
field salesdealer handlingb2b saleslead generation

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
field salesdealer handlingb2b saleslead generation

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
dealer channel managementb2b saleslead generationdealer handling

What will you drive As a Key Account Manager DR at CARS24, you will be responsible for building and strengthening our dealer network through on-ground engagement and lead generation. Your ke...
field salesdealer handlingdealer channel managementb2b sales